Recombinant Bartonella tribocorum Large-conductance mechanosensitive channel (mscL)

What is the Bartonella tribocorum mscL protein and what is its significance in research?

The Bartonella tribocorum large-conductance mechanosensitive channel (mscL) is a membrane protein that plays a crucial role in osmotic regulation. This channel opens in response to membrane tension, allowing the rapid release of cytoplasmic solutes when bacteria experience hypoosmotic shock. Its significance in research stems from its role in bacterial survival mechanisms and its potential as a model for studying mechanosensation across bacterial species .

The protein consists of 136 amino acids with the sequence: "MFKEFKEFALKGNMIDLAIGVIIGGAFGSLVNSIVNDIFMPIIGLITGGIDFSNMFIQLAGEKQATLSAAKAAGATISYGHFITLLINFLIIAWVLFFFVKAMNKMRRKEEGESPNKTSEEQLLTEIRDLLAKKK" . The recombinant version is typically expressed with an N-terminal His-tag to facilitate purification and functional studies .

How does Bartonella tribocorum fit into the broader context of Bartonella species research?

Bartonella tribocorum is one of several Bartonella species that have been extensively studied to understand bacterial evolution, host-pathogen interactions, and mechanisms of infection. Bartonella species are intracellular alpha-Proteobacteria that cause short-lived infections (4 weeks to 2 months) primarily in rodents, though some can cause re-emerging human diseases .

The genome of B. tribocorum has been sequenced, revealing important insights about its virulence factors and evolutionary relationships with other Bartonella species . Research has shown that Bartonella species exhibit high genetic diversity and undergo frequent recombination, which contributes to their adaptation to different hosts and environments .

What expression systems are commonly used for recombinant production of B. tribocorum mscL?

The most widely used expression system for recombinant production of B. tribocorum mscL is Escherichia coli . This bacterial expression system is preferred due to:

• High protein yield

• Cost-effectiveness

• Ease of genetic manipulation

• Rapid growth kinetics

• Compatibility with membrane protein expression

The recombinant protein is typically fused to an N-terminal His-tag to facilitate purification using affinity chromatography techniques . Expression can be optimized by adjusting parameters such as induction temperature, inducer concentration, and host strain selection to maximize functional protein yield.

What purification methods are most effective for recombinant B. tribocorum mscL?

The purification of recombinant B. tribocorum mscL typically follows a multi-step process optimized for membrane proteins:

• Membrane isolation: Following cell lysis, membranes containing the expressed mscL are separated from cytosolic components through differential centrifugation.

• Solubilization: The membrane fraction is solubilized using detergents that maintain protein structure and function, such as n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin.

• Affinity chromatography: The His-tagged protein is purified using Ni-NTA or IMAC columns .

• Size exclusion chromatography: This step removes aggregates and provides the protein in a homogeneous state.

• Detergent exchange: If needed for functional studies, the protein can be exchanged into different detergents or reconstituted into lipid bilayers.

The purity of the final product should exceed 90% as determined by SDS-PAGE analysis . Storage conditions are critical, with recommendations against repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week .

How can researchers effectively reconstitute recombinant B. tribocorum mscL into lipid bilayers for functional studies?

Reconstitution of recombinant B. tribocorum mscL into lipid bilayers for functional studies requires careful optimization of lipid composition and reconstitution conditions:

Methodological approach:

• Lipid selection: E. coli polar lipid extract or a defined mixture of phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin in a ratio mimicking bacterial membranes provides a native-like environment.

• Reconstitution technique options:

  • Detergent dialysis: Gradual removal of detergent through dialysis

  • Detergent adsorption: Using Bio-Beads or similar materials for rapid detergent removal

  • Direct incorporation: Directly incorporating detergent-solubilized protein into preformed liposomes

• Protein-to-lipid ratio optimization: Typically, ratios between 1:100 and 1:1000 (w/w) protein:lipid are tested to achieve optimal channel density.

• Quality control: Reconstitution efficiency should be verified through freeze-fracture electron microscopy, dynamic light scattering, or functional assays.

For patch-clamp electrophysiology experiments, the reconstituted channels should be incorporated into giant unilamellar vesicles or planar lipid bilayers to allow for direct measurement of channel conductance and mechanosensitive properties.

How does the genetic diversity of Bartonella species influence the structure and function of mscL proteins?

The genetic diversity and recombination observed across Bartonella species have significant implications for mscL structure and function:

Bartonella species exhibit extensive genetic diversity due to both mutational processes and frequent recombination events between species . This diversity extends to genes encoding membrane proteins, which may affect the structure and function of proteins like mscL.

Studies of Bartonella isolates from wild rodents have identified numerous recombination events that cross the boundaries of conventionally recognized Bartonella species . Such recombination contributes to the evolution of diverse protein variants with potentially altered functions.

The comparison of mscL sequences from different Bartonella species reveals:

• Conserved transmembrane domains essential for channel function

• Variable regions that may influence host-specific adaptation

• Potential recombination hotspots where genetic exchange occurs frequently

Research suggests that this diversity may contribute to the adaptation of Bartonella to different hosts and environmental conditions, potentially influencing the mechanosensitive properties of the mscL channel and its role in bacterial survival under osmotic stress.

What are the challenges in designing patch-clamp experiments to characterize the electrophysiological properties of recombinant B. tribocorum mscL?

Patch-clamp experiments to characterize B. tribocorum mscL present several technical challenges that researchers must address:

• Channel reconstitution: Achieving consistent incorporation of channels in the correct orientation within artificial membranes.

• Mechanical stimulation protocols: Developing reliable methods to apply defined membrane tension that mimics physiological conditions:

  • Suction through patch pipette

  • Membrane stretching using specialized apparatus

  • Asymmetric insertion of amphipaths into the bilayer

• Signal-to-noise optimization: Mechanosensitive channels often have complex kinetics requiring high-resolution recordings:

  • Gigaohm seal formation

  • Capacitance and leak current compensation

  • Optimized filtering and sampling parameters

• Data interpretation complexities:

  • Distinguishing single-channel from multi-channel events

  • Quantifying the relationship between membrane tension and open probability

  • Determining conductance states and subconductance levels

• Experimental conditions: Optimizing buffer composition, pH, temperature, and membrane composition to maintain channel functionality while facilitating accurate measurements.

A systematic approach involving multiple complementary techniques, including patch-clamp electrophysiology, fluorescence-based flux assays, and structural studies, is recommended for comprehensive characterization.

How does B. tribocorum mscL compare structurally and functionally to mscL from model organisms like E. coli?

Comparative analysis of B. tribocorum mscL with the well-characterized E. coli mscL reveals important similarities and differences:

This comparative approach provides insights into the evolution of mechanosensitive channels and helps identify key structural elements that may be targeted in future research on bacterial membrane proteins and their roles in osmotic regulation and pathogenesis.

What insights can studying B. tribocorum mscL provide about bacterial adaptation to host environments?

Studying B. tribocorum mscL offers unique perspectives on bacterial adaptation to host environments:

Bartonella species are remarkable for their ability to adapt to diverse mammalian hosts. B. tribocorum has been found in various rodent species, suggesting adaptation to different host physiological conditions . The mscL channel may play a crucial role in this adaptation by:

• Osmotic protection: Enabling bacterial survival during transitions between different host environments with varying osmolarity.

• Stress response regulation: Potentially contributing to bacterial responses to host immune defenses that alter membrane properties.

• Host-specific adaptations: Sequence variations in mscL may reflect adaptation to specific host cell types or physiological conditions.

• Inter-species recombination influence: The extensive recombination observed among Bartonella species may contribute to the optimization of mscL function in different hosts. Evidence suggests that genes may be exchanged between Bartonella species that infect the same host, potentially enhancing adaptation through acquisition of host-specific variants.

Research comparing mscL sequences from Bartonella isolates from different host species could reveal how this mechanosensitive channel has evolved to support bacterial survival in diverse mammalian hosts, providing insights into the molecular mechanisms of host adaptation.

What are the potential applications of B. tribocorum mscL in developing antimicrobial strategies?

The unique properties of B. tribocorum mscL present several promising avenues for antimicrobial development:

• Channel-targeting antimicrobials: Compounds that specifically bind to and constitutively open mscL channels would cause uncontrolled solute efflux, disrupting bacterial homeostasis. This approach could be particularly effective because:

  • MscL is highly conserved across bacterial species

  • The channel has no human homologs, reducing potential toxicity

  • Constitutive opening leads to bacterial cell death through osmotic dysregulation

• Host-pathogen interface disruption: As B. tribocorum is a pathogen that transitions between vector and mammalian hosts, targeting mscL could disrupt adaptation to changing osmotic environments during infection.

• Delivery system for conventional antibiotics: Controlled activation of mscL could increase bacterial membrane permeability, enhancing the uptake of conventional antibiotics that typically struggle to penetrate bacterial membranes.

• Resistance mitigation strategies: The essential nature of mscL for bacterial survival under osmotic stress makes it less susceptible to resistance development, as mutations affecting channel function would likely compromise bacterial viability.

Challenges in this approach include developing compounds with specificity for bacterial mscL channels and ensuring sufficient bioavailability at infection sites.

How can genetic diversity studies of Bartonella species inform our understanding of the evolution of mechanosensitive channels?

Genetic diversity studies of Bartonella species provide a unique window into mechanosensitive channel evolution:

The extensive recombination and genetic diversity observed in Bartonella species creates a natural laboratory for studying protein evolution. Analysis of mscL across diverse Bartonella isolates reveals:

• Evolutionary constraints: Identification of highly conserved regions despite frequent recombination events suggests functional constraints on channel structure.

• Host-specific adaptations: Correlation between mscL variants and host species may reveal adaptive modifications to different cellular environments .

• Recombination as an evolutionary driver: The mosaic nature of Bartonella genomes, with evidence of gene exchange between species , indicates that recombination contributes significantly to mechanosensitive channel diversification and optimization.

• Selective pressures: Comparative analysis of synonymous versus non-synonymous mutations in mscL sequences can reveal selective pressures acting on this channel.

Studies have shown that Bartonella isolates from Microtus (vole) species frequently participate in recombination events , suggesting that host ecology influences bacterial genetic exchange. This has implications for understanding how mechanosensitive channels evolve in response to specific host environments.

The extensive recombination observed in Bartonella species challenges traditional species boundaries and suggests that functional adaptation through gene exchange may be more important than maintaining species integrity in these bacteria.