Recombinant Bartonella tribocorum NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nuoK; BT_1207; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Bartonella tribocorum (strain CIP 105476 / IBS 506)
Target Names
nuoK
Target Protein Sequence
MYIDITHYLTVSALMFTIGIAGIFLNRKNVIIILMSIELILLSVNINFVAFSAFLHDLVG QIFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDVNVMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this species, ubiquinone is believed to be the immediate electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Bartonella tribocorum and what is its significance in research?

Bartonella tribocorum is a gram-negative bacterium belonging to the genus Bartonella, which includes various zoonotic pathogens associated with human and animal diseases. B. tribocorum primarily circulates among rodent populations, particularly wild Mus species, and can establish long-term bacteremia in these hosts . The organism serves as an important model for studying Bartonella infections due to its ability to establish persistent bacteremia in laboratory mice that closely resembles infections in natural hosts . Experimental infection studies demonstrate that B. tribocorum can maintain bacteremia in mice for up to 25 weeks, sometimes with intermittent abacteremic intervals, and can achieve blood concentrations as high as 10^7 CFU/ml . This prolonged infection pattern makes it particularly valuable for investigating host-pathogen interactions, bacterial adaptation mechanisms, and potential therapeutic interventions for bartonellosis. The organism shares significant genetic and physiological characteristics with human-pathogenic Bartonella species, enabling comparative studies of virulence factors and metabolic pathways across the genus .

  • What is the function of NADH-quinone oxidoreductase subunit K (nuoK) in Bartonella species?

NADH-quinone oxidoreductase subunit K (nuoK) is an integral component of Complex I in the bacterial respiratory chain. In Bartonella species, this enzyme plays a critical role in energy metabolism by catalyzing electron transfer from NADH to quinones, contributing to ATP generation through oxidative phosphorylation . The NADH-quinone oxidoreductase complex (also known as NADH dehydrogenase I) comprises multiple subunits, with nuoK functioning as a membrane-embedded component that participates in proton translocation across the cell membrane . This process generates the proton motive force necessary for ATP synthesis. The enzyme is particularly important for Bartonella species, which must adapt their metabolism to survive in diverse environments within various mammalian hosts and arthropod vectors . The functional mechanism of nuoK likely involves electron transfer from NADH to the substrate through specific residues that form a quinone-binding channel, similar to what has been observed in other quinone oxidoreductases . This energy generation capability is essential for bacterial survival, replication, and persistence within host tissues.

  • How is recombinant Bartonella tribocorum NADH-quinone oxidoreductase typically expressed and purified?

Recombinant Bartonella tribocorum NADH-quinone oxidoreductase subunit K (nuoK) is typically expressed using heterologous expression systems similar to those employed for other Bartonella proteins. Based on established protocols for related proteins, expression commonly occurs in prokaryotic (E. coli) or eukaryotic (yeast, baculovirus, or mammalian cell) systems . For E. coli expression, the nuoK gene is cloned into an expression vector containing an appropriate promoter and often includes fusion tags (such as histidine or GST tags) to facilitate purification. After transformation and induction of protein expression, cells are harvested and lysed, and the recombinant protein is purified through affinity chromatography based on the fusion tag .

For membrane proteins like nuoK, specialized approaches are necessary for successful expression and purification. These include the use of detergents or lipid environments to maintain protein structure and function during solubilization and purification steps. Quality control typically involves SDS-PAGE analysis to confirm protein purity (typically >90% is considered acceptable for most applications), along with immunoblotting to verify identity . The purified protein is commonly stored in a glycerol-containing buffer at -20°C or -80°C to maintain stability, with working aliquots kept at 4°C for up to one week to avoid repeated freeze-thaw cycles that can compromise protein integrity .

  • What are the common vectors and hosts for Bartonella tribocorum?

Bartonella tribocorum primarily circulates in rodent populations, with wild Mus species serving as the main natural reservoir hosts . Experimental studies have demonstrated that laboratory mice, specifically outbred CD1 female mice, are susceptible to B. tribocorum infection and can develop persistent bacteremia lasting up to 25 weeks, making them suitable experimental hosts for research purposes . In these mouse models, bacteremia can reach levels as high as 10^7 CFU/ml of blood, with researchers noting interesting temporal patterns including delayed onset of bacteremia (up to 19 weeks post-inoculation) and intermittent abacteremic intervals .

Bartonella SpeciesHost(s)Vector(s)
B. henselaeCat, human, dogs, horsesFleas, lice, ticks, spiders
B. quintanaHumans, macaques, cats, dogsHuman body lice, fleas, bed bugs
B. bacilliformisHumansSandflies, fleas
B. tribocorumWild Mus spp., laboratory micePresumed to be fleas, ticks
B. vinsonii ssp. berkhoffiDogs, horses, foxes, humansFleas, ticks
B. koehleraeCats, dogs, humansFleas
  • How does the structure of NADH-quinone oxidoreductase compare across different Bartonella species?

While detailed structural comparisons of NADH-quinone oxidoreductase (nuoK) across different Bartonella species are not explicitly described in the available literature, insights can be drawn from related structures and homologous enzymes. NADH-quinone oxidoreductases generally exhibit a conserved topology across bacterial species, although variations exist in the active sites that reflect differences in substrate specificities .

Based on the structure of NADPH-dependent QOR from Phytophthora capsici (PcQOR), which shares functional similarities, we can infer that Bartonella nuoK likely adopts a bi-modular architecture with specific domains for cofactor binding and substrate interaction . The enzyme typically contains a NADH/NADPH-binding groove and a substrate-binding pocket in each subunit . The NADH-binding domain likely adopts a Rossmann fold, a conserved structural motif in nucleotide-binding proteins that creates a specific microenvironment for positioning the nicotinamide ring for electron transfer.

Comparing B. tribocorum nuoK with the closely related B. quintana nuoK, both proteins are classified as NADH dehydrogenase I subunit K (EC 1.6.99.5) and likely share high sequence homology and core structural features . Analysis of quaternary structure in related oxidoreductases suggests that these enzymes may form oligomeric assemblies in solution, potentially existing as tetramers, though the specific oligomerization state of Bartonella nuoK would require experimental verification .

Advanced Research Questions

  • What are the critical considerations in designing experiments involving recombinant Bartonella tribocorum NADH-quinone oxidoreductase?

When designing experiments involving recombinant B. tribocorum NADH-quinone oxidoreductase subunit K (nuoK), researchers should address several critical considerations to ensure valid and reproducible results:

Expression System Selection: Choose an appropriate expression system based on the specific experimental goals. While E. coli is commonly used for bacterial proteins, membrane proteins like nuoK often require specialized expression systems that better accommodate membrane insertion and folding . Consider whether the native protein requires specific post-translational modifications or cofactors for activity, which may necessitate eukaryotic expression systems.

Protein Solubilization and Stability: Develop effective solubilization strategies using appropriate detergents or lipid environments, as nuoK is a membrane protein. Monitor protein stability throughout purification and storage, as membrane proteins are prone to aggregation or denaturation when removed from their native lipid environment . Consider reconstitution into nanodiscs or liposomes for functional studies.

Functional Assessment: Design assays to verify that the recombinant protein retains its native activity. For nuoK, this would involve measuring electron transfer from NADH to quinone substrates. Consider adapting enzymatic assays similar to those used for the NADPH-dependent QOR from P. capsici, which evaluated activity with various quinone substrates like 9,10-phenanthrenequinone .

Structural Characterization: If structural studies are planned, determine whether X-ray crystallography, cryo-EM, or other structural techniques are most appropriate. Consider whether the protein should be studied in isolation or as part of the larger complex I assembly to maintain physiological relevance .

In Vivo Studies: For experiments involving animal models, consider the infection characteristics observed in previous B. tribocorum mouse models, including expected bacteremia levels (up to 10^7 CFU/ml) and temporal patterns of infection . Plan for potential delays in bacteremia onset (up to 19 weeks post-inoculation) and intermittent abacteremic intervals.

  • How can researchers effectively assess the enzymatic activity of recombinant B. tribocorum NADH-quinone oxidoreductase?

Effectively assessing the enzymatic activity of recombinant B. tribocorum NADH-quinone oxidoreductase subunit K requires a multi-faceted approach combining various biochemical and biophysical techniques:

Spectrophotometric Assays: Monitor the oxidation of NADH by measuring the decrease in absorbance at 340 nm, which corresponds to NADH consumption during electron transfer to quinone substrates. This approach allows for real-time monitoring of enzyme kinetics and determination of reaction rates under different conditions .

Substrate Specificity Analysis: Test a panel of quinone substrates to establish substrate preferences and determine kinetic parameters (Km, Vmax, kcat). Based on studies of similar enzymes, compounds like 9,10-phenanthrenequinone and methyl-1,4-benzoquinone should be included in the substrate panel, as these have shown effective interaction with related quinone oxidoreductases .

Inhibitor Studies: Evaluate the effect of known inhibitors of NADH-quinone oxidoreductase to confirm the enzymatic mechanism and assess potential for modulation. Dose-response curves with varying inhibitor concentrations can provide insights into inhibition mechanisms (competitive, non-competitive, etc.) and binding affinities.

Site-Directed Mutagenesis: Create variants with mutations in key active site residues (predicted based on homology to characterized enzymes like PcQOR) to elucidate the roles of specific amino acids in catalysis. For instance, mutations analogous to R45, Q48, Y54, C147, and T148 in PcQOR might provide valuable insights into the catalytic mechanism .

Environmental Factor Assessment: Evaluate the effects of pH, temperature, ionic strength, and potential cofactors on enzyme activity to determine optimal reaction conditions and physiological constraints that might influence function in different host environments.

The integration of these approaches provides a comprehensive assessment of enzymatic activity, offering insights into both fundamental enzyme properties and potential applications in research or therapeutic development.

  • What structural insights about NADH-quinone oxidoreductase can be applied from studies of similar enzymes in other organisms?

Structural studies of related quinone oxidoreductases provide valuable insights that can be applied to understanding B. tribocorum NADH-quinone oxidoreductase subunit K (nuoK). The crystal structure of NADPH-dependent QOR from Phytophthora capsici (PcQOR) complexed with NADPH at 2.4 Å resolution offers particularly relevant comparative information :

Bi-modular Architecture: Similar to PcQOR, B. tribocorum nuoK likely exhibits a bi-modular structure with distinct domains for cofactor binding and substrate interaction. This organization creates specialized microenvironments for different stages of the catalytic process, with one domain adopting the Rossmann fold for nucleotide binding and another forming a substrate-binding pocket .

Catalytic Mechanism: The catalytic mechanism likely involves a sequential process where: (1) the quinone substrate enters the active pocket and is positioned by key residues; (2) electron transfer proceeds when the phenyl ring of quinone stacks against the nicotinamide ring of NADH; (3) the increased hydrophobicity around the positively charged nicotinamide cavity stimulates electron transfer; (4) after reduction of the quinone carbonyl group, hydrogen bonds between the substrate and key residues are broken; and (5) the substrate-binding pocket opens to release the product .

Key Residues in Substrate Binding: Based on the PcQOR structure, specific residues equivalent to R45, Q48, Y54, C147, and T148 likely play critical roles in substrate positioning and catalysis in B. tribocorum nuoK. These residues create a defined quinone-binding channel that allows for specific substrate recognition and optimal positioning for electron transfer .

Oligomeric State: PcQOR functions as a tetramer in solution, stabilized by intermolecular interactions. While the oligomerization state of B. tribocorum nuoK would need to be experimentally determined, the interfaces involved in oligomer formation might be conserved across related enzymes .

These structural insights provide a framework for understanding nuoK function and can guide experimental approaches for characterizing the B. tribocorum enzyme, including the design of site-directed mutagenesis studies to probe specific aspects of enzyme function.

  • What are the challenges in expressing functional Bartonella tribocorum NADH-quinone oxidoreductase in heterologous systems?

Expressing functional Bartonella tribocorum NADH-quinone oxidoreductase subunit K (nuoK) in heterologous systems presents several significant challenges that researchers must address:

Membrane Protein Integration: As nuoK is a membrane-embedded subunit of Complex I, it requires proper membrane insertion for correct folding and function. Standard expression systems may not provide the appropriate membrane environment, leading to protein misfolding, aggregation, or degradation . Specialized expression vectors or host strains engineered for membrane protein expression may be necessary.

Complex Subunit Interactions: In its native context, nuoK functions as part of the larger Complex I, interacting with multiple other subunits. Expressing nuoK in isolation may result in an incomplete functional unit that lacks critical protein-protein interactions necessary for activity and stability . Co-expression of interacting subunits may be required to maintain proper folding and function.

Cofactor Requirements: The proper assembly and function of NADH-quinone oxidoreductase often depends on specific cofactors and prosthetic groups. Ensuring the availability and correct incorporation of these components in heterologous systems can be challenging and may require supplementation of growth media or inclusion in purification buffers .

Post-translational Modifications: If nuoK requires specific post-translational modifications for function, the heterologous expression system must be capable of performing these modifications correctly. Bacterial systems like E. coli may lack the necessary modification machinery present in Bartonella .

Toxicity to Host Cells: Overexpression of membrane proteins can disrupt the host cell membrane integrity and metabolism, potentially leading to growth inhibition or cell death. This is particularly relevant for proteins involved in electron transport, as they may interfere with the host's own respiratory machinery . Inducible expression systems with tight regulation may help mitigate this issue.

To address these challenges, researchers might consider using specialized membrane protein expression systems, co-expressing multiple Complex I subunits, employing host systems with membrane compositions similar to Bartonella, exploring cell-free expression systems for toxic proteins, or developing native-like membrane mimetics for protein reconstitution after purification.

  • How might mutations in the nuoK gene affect the pathogenicity of Bartonella tribocorum?

Mutations in the nuoK gene encoding NADH-quinone oxidoreductase subunit K could potentially impact the pathogenicity of Bartonella tribocorum through several interrelated mechanisms:

Energy Metabolism Disruption: As a component of Complex I in the respiratory chain, nuoK is crucial for energy production through electron transport and proton translocation. Mutations affecting its function could compromise ATP generation, reducing bacterial replication rates and persistence in host tissues . This might be particularly significant during the bacteremic phase of infection, where B. tribocorum can achieve levels up to 10^7 CFU/ml of blood in experimental mouse models . Reduced energy production could translate to attenuated virulence or shortened duration of infection.

Adaptation to Host Environments: Bartonella species must adapt to diverse environments within mammalian hosts and arthropod vectors, which likely requires metabolic flexibility . Mutations in nuoK could affect the bacterium's ability to adjust its metabolism to these different niches, potentially compromising transmission or establishment of infection. This could be particularly relevant during transitions between host types or between bloodstream and tissue phases of infection .

Redox Homeostasis: NADH-quinone oxidoreductase plays a role in maintaining cellular redox balance. Mutations could lead to redox imbalance, potentially increasing susceptibility to host-generated oxidative stress or affecting the regulation of virulence factors whose expression is redox-sensitive . This could influence bacterial survival within phagocytic cells or tissues with high oxidative environments.

Structural Integrity: If mutations disrupt key residues involved in electron transfer (similar to R45, Q48, Y54, C147, and T148 identified in PcQOR), enzyme activity could be compromised to varying degrees . The severity would depend on whether the mutations affect catalytic residues, substrate binding sites, or structural elements of the protein. Complete loss of function versus partial reduction in activity could have dramatically different effects on bacterial fitness.

Experimental investigation of these effects could utilize the established mouse model of B. tribocorum infection , comparing wild-type strains with nuoK mutants to assess changes in infection dynamics, including bacteremia onset, duration, and intensity.

  • What are the most effective protocols for studying protein-protein interactions involving B. tribocorum NADH-quinone oxidoreductase?

Studying protein-protein interactions involving B. tribocorum NADH-quinone oxidoreductase subunit K (nuoK) requires specialized approaches that account for its membrane-embedded nature and integration within Complex I. Based on methods used for similar systems, the following protocols are particularly effective:

Co-immunoprecipitation with Membrane-Compatible Detergents: Use mild detergents (such as DDM, LMNG, or digitonin) that preserve native protein-protein interactions while solubilizing membrane complexes. Antibodies against nuoK or a tagged version of the protein can be used to pull down interacting partners, followed by mass spectrometry identification of co-precipitated proteins .

Blue Native PAGE (BN-PAGE): This technique allows separation of intact membrane protein complexes under native conditions while preserving quaternary structure. When combined with a second-dimension SDS-PAGE, it can resolve individual components of the Complex I interactome while maintaining information about native interactions and complex size .

Crosslinking Mass Spectrometry (XL-MS): Chemical crosslinking followed by mass spectrometry analysis can capture transient or weak interactions within the respiratory complex. This approach is particularly valuable for mapping the spatial arrangement of nuoK relative to other Complex I subunits and can identify interaction interfaces at the amino acid level .

Bioluminescence Resonance Energy Transfer (BRET) or Förster Resonance Energy Transfer (FRET): These techniques detect direct protein-protein interactions in real-time and potentially in living cells. They involve tagging nuoK and potential interacting partners with appropriate donor and acceptor molecules, with energy transfer occurring only when the proteins are in close proximity .

Surface Plasmon Resonance (SPR) with Membrane Mimetics: For quantitative measurement of binding kinetics between purified nuoK and interaction partners, SPR can be utilized with the protein incorporated into lipid nanodiscs or similar membrane mimetics. This provides both qualitative interaction data and quantitative binding constants .

These methods, especially when used in combination, can provide comprehensive insights into the protein-protein interaction network of B. tribocorum nuoK, elucidating its role within the respiratory complex and potentially identifying novel interaction partners relevant to bacterial physiology and pathogenesis.

  • How can researchers distinguish between different Bartonella species based on nuoK gene analysis?

Researchers can effectively distinguish between different Bartonella species through nuoK gene analysis using several molecular approaches that exploit sequence variations between species:

PCR Amplification and Product Size Analysis: Design primers targeting conserved regions flanking variable segments of the nuoK gene. The amplified products will have species-specific sizes that can be distinguished by gel electrophoresis, similar to the approach used for the 16S-23S rRNA intergenic region in Bartonella identification . This method is particularly valuable for rapid screening of clinical or environmental samples without requiring sequencing.

Sequence Analysis and Phylogenetics: After amplification, sequencing the nuoK gene provides the most definitive species identification. Comparative sequence analysis can reveal species-specific nucleotide signatures and phylogenetic relationships. Constructing phylogenetic trees based on nuoK sequences can help classify unknown isolates and understand evolutionary relationships between Bartonella species .

Restriction Fragment Length Polymorphism (RFLP): After PCR amplification of the nuoK gene, treatment with specific restriction enzymes can generate species-specific fragmentation patterns. This approach can distinguish between closely related species without requiring sequencing, providing a cost-effective alternative for routine identification.

Real-Time PCR with Species-Specific Probes: Design TaqMan or molecular beacon probes targeting species-specific regions within the nuoK gene. This allows for rapid, sensitive, and specific detection of particular Bartonella species in a single reaction, with potential for quantification of bacterial load.

The sensitivity of nuoK-based detection methods would likely be comparable to that observed for 16S-23S rRNA-based assays, which could detect B. henselae in 100% of samples with greater than 50 CFU/ml and 80% of samples with 10-30 CFU/ml . These molecular approaches provide powerful tools for identifying and differentiating Bartonella species in research, clinical, and epidemiological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.