Recombinant Bat coronavirus 133/2005 Membrane protein (M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-219
Protein Length
full length protein
Species
Bat coronavirus 133/2005 (BtCoV) (BtCoV/133/2005)
Target Names
M
Target Protein Sequence
MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPAS MALSIFSAIYPISLASQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLN VPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKM VKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA
Uniprot No.

Target Background

Function
A viral envelope component crucial for virus morphogenesis and assembly through interactions with other viral proteins.
Protein Families
Betacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the Membrane protein and how does it function in bat coronaviruses?

The Membrane (M) protein is the most abundant glycoprotein in the coronavirus virion structure and plays essential roles in viral assembly and budding. In bat coronaviruses, as in other coronaviruses, the M protein consists of a short N-terminal ectodomain, three transmembrane domains, and a long C-terminal endodomain. The protein typically ranges from 220-260 amino acids in length, with a molecular weight of approximately 25-30 kDa. The M protein functions primarily by interacting with other structural proteins including the nucleocapsid (N) protein and the envelope (E) protein to facilitate virion assembly. Unlike the highly variable Spike protein that determines host range through receptor binding, the M protein is more conserved across coronavirus strains, though still contains species-specific variations that may influence viral fitness in different hosts. Research approaches to study M protein function typically involve recombinant expression systems, site-directed mutagenesis, and protein-protein interaction assays to map functional domains .

How do researchers express recombinant bat coronavirus M proteins for laboratory studies?

Expression of recombinant bat coronavirus M proteins requires careful consideration of expression systems to ensure proper folding and membrane insertion. Researchers typically employ several methodological approaches:

  • Bacterial Expression Systems: While economical, bacterial systems like E. coli often struggle with membrane protein expression and may require specialized strains designed for membrane proteins. Fusion tags such as His6, MBP, or GST are commonly added to improve solubility and facilitate purification.

  • Insect Cell Expression: Baculovirus expression systems in Sf9 or High Five insect cells offer more sophisticated post-translational modifications and have been successful for expressing coronavirus membrane proteins with proper folding.

  • Mammalian Cell Expression: For optimal native conformation, mammalian expression systems (HEK293T, Vero cells) are preferred, especially when studying protein-protein interactions in conditions that mimic natural infection. For example, the synthetic recombinant bat SARS-like coronavirus studies utilized mammalian Vero cells for successful virus recovery .

  • Cell-Free Expression Systems: For rapid production of small quantities for preliminary studies, cell-free systems with added microsomes or nanodiscs can support membrane protein synthesis.

The choice of expression system depends on downstream applications, required protein quantity, and whether functional or structural studies are planned. Purification typically involves detergent solubilization followed by affinity chromatography, with careful optimization needed to maintain protein stability and native conformation.

What are the key sequence variations between the M protein of bat coronaviruses and human coronaviruses?

The M protein, while more conserved than the Spike protein, still exhibits notable sequence variations between bat coronaviruses and human coronaviruses that may influence viral biology. Key differences include:

  • Transmembrane Domain Composition: Bat coronavirus M proteins often contain subtle amino acid substitutions in the transmembrane domains that may affect membrane topology and protein-lipid interactions.

  • C-terminal Domain Variations: The endodomain contains several regions with species-specific sequence patterns that influence interactions with other viral proteins, particularly nucleocapsid proteins.

  • Glycosylation Sites: Differential glycosylation patterns exist between bat and human coronavirus M proteins, potentially affecting protein stability and immune recognition.

  • Conserved Motifs: Despite variations, certain functional motifs remain highly conserved, including those involved in protein-protein interactions essential for virion assembly.

When studying these variations, researchers must consider using multiple sequence alignment tools and evolutionary analysis to identify functionally significant differences. Conservation analysis reveals that while sequence identity between bat and human coronavirus M proteins typically ranges from 80-95%, the pattern of conservation is not uniform across the protein, with the C-terminal domain showing greater variability than the transmembrane regions .

How does the M protein interact with other structural proteins during coronavirus assembly?

During coronavirus assembly, the M protein serves as a central organizer through multiple critical interactions:

  • M-N Interactions: The M protein C-terminal domain interacts with the nucleocapsid (N) protein to incorporate the ribonucleocapsid into virions. This interaction can be studied using co-immunoprecipitation, yeast two-hybrid systems, or bimolecular fluorescence complementation assays.

  • M-E Interactions: M protein interacts with the small envelope (E) protein at the ER-Golgi intermediate compartment (ERGIC) to drive membrane curvature and virion budding. These interactions are typically studied using mutational analysis and co-localization microscopy.

  • M-S Interactions: M protein retention in the ERGIC facilitates incorporation of the Spike protein into virions through specific protein-protein interactions. As demonstrated in recombinant bat coronavirus studies, chimeric viruses with modified Spike proteins still require compatible M protein interactions for viable virus production .

  • M-M Interactions: M proteins form homo-oligomeric complexes that create the scaffold for virion assembly, which can be studied using crosslinking experiments and analytical ultracentrifugation.

Experimental approaches to study these interactions include generating recombinant viruses with tagged proteins, conducting pull-down assays, and employing proximity labeling techniques such as BioID or APEX2. Advanced imaging techniques like cryo-electron microscopy have also provided structural insights into these protein complexes within intact virions.

What methodological approaches can be used to study the role of M protein in bat coronavirus zoonotic potential?

Investigating the M protein's contribution to zoonotic potential requires sophisticated methods that analyze both protein function and species-specific adaptations:

  • Reverse Genetics Systems: Constructing chimeric viruses with heterologous M proteins inserted into different coronavirus backbones can reveal compatibility constraints. This approach was successfully used for studying Spike protein chimeras, as demonstrated in the creation of Bat-SRBD chimeric viruses, and can be adapted for M protein research .

  • Cell-Cell Fusion Assays: While primarily used for Spike protein studies, modified fusion assays incorporating M protein variants can test how M proteins from different species affect membrane fusion efficiency and cell-cell spread.

  • Protein Evolution Analysis: Phylogenetic analysis coupled with selection pressure calculations (dN/dS ratios) can identify sites under positive selection in bat coronavirus M proteins that might facilitate adaptation to new hosts.

  • Cross-Species Binding Studies: Immunoprecipitation assays with M proteins from bat coronaviruses and potential interaction partners from human cells can identify species barriers in protein-protein interactions.

  • Structural Prediction and Modeling: Computational approaches using homology modeling and molecular dynamics simulations can predict how M protein mutations might alter interactions with host factors. This approach parallels the successful structural prediction of RBD-ACE2 interactions seen in Spike protein studies .

How does the M protein contribute to immune evasion strategies in bat coronaviruses?

The M protein contributes to immune evasion through several mechanisms that can be investigated through specific experimental approaches:

  • Innate Immune Signaling Modulation: Bat coronavirus M proteins may interact with key components of innate immune pathways. This can be studied through reporter assays measuring interferon production in cells expressing recombinant M proteins, and through protein-protein interaction studies with key immune signaling molecules.

  • MHC-I Downregulation: Some coronavirus M proteins interfere with major histocompatibility complex class I (MHC-I) presentation. Flow cytometry and immunofluorescence assays can quantify changes in surface MHC-I levels in the presence of bat coronavirus M proteins.

  • Antibody Accessibility Studies: The topology of M protein in the virion may shield certain epitopes from antibody recognition. This can be investigated using accessibility assays with surface biotinylation or using conformation-specific antibodies.

  • Comparative Immunogenicity Analysis: Recombinant M proteins from different bat coronavirus strains can be compared for their ability to stimulate immune responses in cell culture and animal models.

When designing experiments to study M protein immune evasion, it's important to include appropriate controls such as M proteins from human coronaviruses with known immune evasion properties. Additionally, immune evasion should be studied in relevant cell types including bat and human immune cells to identify species-specific differences in these mechanisms .

What techniques can be used to map the functional domains of bat coronavirus M proteins?

Mapping functional domains requires systematic approaches to correlate protein structure with specific functions:

  • Alanine Scanning Mutagenesis: Creating a library of M protein variants with sequential alanine substitutions can identify residues critical for specific functions. Each variant can be tested for proper folding, subcellular localization, and protein-protein interactions.

  • Truncation and Chimeric Protein Analysis: Generating truncated versions of the M protein or chimeric constructs with domains swapped between different coronavirus species can identify functional domain boundaries. This approach parallels the successful creation of chimeric Spike proteins in synthetic recombinant bat coronavirus studies .

  • Site-Directed Mutagenesis of Conserved Residues: Targeting evolutionarily conserved amino acids for mutation can identify functionally important sites. Conservation analysis across multiple bat coronavirus species helps prioritize residues for investigation.

  • Protein Fragment Complementation: Split-protein systems where complementary fragments of reporter proteins are fused to potential interacting domains can map interaction surfaces in living cells.

  • Cysteine Accessibility Methods: Substituting specific residues with cysteine followed by chemical modification can probe protein topology and accessibility in membrane environments.

  • Cryo-EM and Structural Analysis: While challenging due to the membrane nature of the protein, structural studies using detergent-solubilized or nanodisc-incorporated M proteins can provide detailed insights into domain organization.

Data from these approaches should be integrated to create comprehensive functional maps of the M protein, correlating sequence features with biological activities and establishing structure-function relationships.

How do mutations in the M protein affect virus fitness compared to mutations in other structural proteins?

Comparative mutational analysis provides insights into the relative contribution of M protein to viral fitness:

  • Competition Assays: Mixed infections with wild-type and M protein mutant viruses can determine relative fitness through quantitative PCR analysis of viral population composition over serial passages.

  • Growth Curve Analysis: Comparing replication kinetics of M protein mutants with other structural protein mutants (Spike, Envelope, Nucleocapsid) can establish relative impact on viral growth.

  • Plaque Size Phenotyping: Variations in plaque morphology between different structural protein mutants can indicate differential effects on cell-to-cell spread and cytopathic effect.

  • Thermostability Assays: Heat inactivation experiments can reveal how M protein mutations affect virion stability compared to mutations in other structural proteins.

  • Trans-Complementation Studies: Using cell lines expressing wild-type M protein to rescue growth of M protein mutants can identify essential versus non-essential functions.

Studies with synthetic recombinant bat SARS-like coronaviruses demonstrated that while Spike protein RBD determines host range specificity, successful virus recovery requires compatible interactions with other structural proteins, including M protein . This suggests a cooperative relationship where the M protein provides an essential scaffolding function that must accommodate variations in other structural proteins.

What reverse genetics systems are most effective for studying bat coronavirus M protein function?

Several reverse genetics approaches have proven effective for coronavirus research, each with advantages for specific research questions about M protein function:

  • Bacterial Artificial Chromosome (BAC) Systems: BAC-based systems allow stable maintenance of the full coronavirus genome in bacterial cells, facilitating creation of targeted M protein mutations through bacterial recombination enzymes. This approach is particularly useful for creating libraries of M protein variants but requires specialized facilities for handling large BAC constructs.

  • In Vitro Assembly of cDNA Fragments: As demonstrated in the synthetic recombinant bat SARS-like coronavirus studies, coronavirus genomes can be assembled from multiple cDNA fragments with unique restriction sites . For studying M protein, this involves:

    • Designing fragments with restriction sites flanking the M gene

    • Creating mutant M gene fragments using PCR-based mutagenesis

    • Assembling full-length genomic cDNA with the mutant fragment

    • In vitro transcription to generate infectious RNA

    • Electroporation into susceptible cells

  • Targeted RNA Recombination: This system uses recombination between a donor RNA containing M protein mutations and a recipient coronavirus genome. While technically simpler than full genome assembly, this approach is more limited in the range of mutations that can be introduced.

  • Infectious cDNA Clones: Yeast-based artificial chromosome systems or low-copy plasmid systems can maintain complete coronavirus genomes for genetic manipulation of the M protein coding region.

When designing reverse genetics experiments, biosafety considerations are paramount. Work with synthetic bat coronaviruses requires appropriate containment facilities and risk assessment, as even non-human coronaviruses may acquire human infectivity through recombination or mutation, as demonstrated by the T403R mutation in RaTG13 that allowed human ACE2 binding .

What cell culture systems are optimal for studying bat coronavirus M protein function and interactions?

Selection of appropriate cell culture systems is critical for M protein research:

  • Bat-Derived Cell Lines: Cells derived from relevant bat species provide the most authentic cellular context. Common lines include:

    • Pteropus alecto kidney cells (PaKi)

    • Rhinolophus sinicus lung cells (RS-lung)

    • Myotis davidii lung epithelial cells

  • Human Respiratory Epithelial Models: For studying M protein function in human cells:

    • Primary human airway epithelial (HAE) cultures provide a physiologically relevant model

    • Calu-3 (human lung adenocarcinoma) cells

    • Human airway organoids for 3D architecture studies

  • Common Laboratory Cell Lines: For basic mechanistic studies:

    • Vero E6 cells (African green monkey kidney) support growth of many bat-derived coronaviruses

    • HEK293T cells for protein expression and interaction studies

    • BHK-21 cells for high-efficiency transfection experiments

  • Co-Culture Systems: To study M protein's role in cell-cell interactions, co-cultures of immune cells with epithelial cells expressing M protein variants can be employed.

  • Inducible Expression Systems: Tet-On/Off systems allow controlled expression of potentially toxic M protein variants for long-term studies.

When establishing these systems, careful validation is required, including confirmation of protein expression by western blot, proper localization by immunofluorescence microscopy, and functional assessment through virus rescue experiments when applicable. For chimeric viruses containing heterologous M proteins, replication competence should be assessed through multiple passages to confirm stability, as was done with the Bat-SRBD chimeric viruses .

What are the best approaches for analyzing M protein-mediated virus assembly in bat coronaviruses?

Studying the role of M protein in virus assembly requires multifaceted approaches:

  • Transmission Electron Microscopy (TEM): TEM analysis of infected cells can reveal ultrastructural details of virion assembly sites and morphological abnormalities in M protein mutants. Immunogold labeling can specifically localize M protein relative to other viral components. Sample preparation typically involves:

    • Fixation in glutaraldehyde and osmium tetroxide

    • Dehydration through ethanol series

    • Embedding in epoxy resin

    • Ultrathin sectioning (60-80 nm)

    • Staining with uranyl acetate and lead citrate

  • Virus-Like Particle (VLP) Production: Co-expression of M protein with E protein (minimum requirement) or with N and S proteins creates VLPs that can be analyzed for assembly efficiency. Quantification methods include:

    • Density gradient ultracentrifugation to purify VLPs

    • ELISA or western blot quantification of VLP yield

    • Nanoparticle tracking analysis for size distribution

    • Cryo-EM for structural characterization

  • Live-Cell Imaging: Fluorescently tagged M proteins enable real-time visualization of trafficking and assembly:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility

    • RUSH (Retention Using Selective Hooks) system to synchronize protein trafficking

    • Multi-color imaging to track co-localization with other viral proteins

  • Biochemical Fractionation: Subcellular fractionation combined with western blotting can track M protein distribution and association with membrane compartments during the assembly process.

  • Proximity Labeling Proteomics: BioID or APEX2 fusion to M protein can identify proximal proteins during assembly, creating a spatial map of interactions.

Data interpretation should consider that M protein mutations might affect multiple stages of virion formation, from protein trafficking to membrane curvature induction to incorporation of other structural proteins .

What biosafety considerations are critical when working with recombinant bat coronaviruses containing modified M proteins?

Research with recombinant bat coronaviruses requires comprehensive biosafety measures:

  • Risk Assessment Framework:

    • Evaluate the potential for human infection based on receptor usage

    • Consider envelope protein composition, especially chimeric constructs

    • Assess replication competence in human cell lines

    • Review potential for immune evasion or enhanced pathogenicity

  • Containment Requirements:

    • Work with recombinant bat coronaviruses typically requires BSL-3 facilities

    • Enhanced BSL-3 practices may be needed for chimeric viruses with human coronavirus components

    • Specific engineering controls include Class II biosafety cabinets, HEPA filtration, and negative pressure rooms

  • Personnel Safeguards:

    • Comprehensive training on coronavirus-specific procedures

    • Respiratory protection (N95/PAPR) when handling infectious materials

    • Vaccination of personnel when available

    • Health monitoring and serum banking protocols

  • Risk Mitigation Strategies:

    • Design attenuating mutations in accessory genes when possible

    • Consider split genome systems for highly pathogenic constructs

    • Use surrogate systems like pseudotyped viruses for initial studies

    • Implement neutralization validation tests as demonstrated with Bat-SRBD chimeric viruses, where antibodies against both bat and human coronaviruses neutralized the recombinant virus

  • Regulatory Compliance:

    • Institutional Biosafety Committee (IBC) approval required

    • Potential for additional oversight for certain gain-of-function research

    • Documentation of risk assessment and mitigation strategies

Researchers should note that even seemingly minor modifications to the M protein could potentially affect virulence or transmission characteristics, requiring careful monitoring during experiments. The experience with the synthetic recombinant bat SARS-like coronavirus demonstrates that chimeric viruses can be engineered safely with appropriate precautions .

How can researchers address the technical challenges in expressing and purifying full-length recombinant bat coronavirus M proteins?

Membrane protein expression presents unique challenges that require specialized approaches:

  • Toxicity Management Strategies:

    • Use tightly controlled inducible expression systems (Tet-On/Off)

    • Employ low-copy number vectors to reduce basal expression

    • Optimize induction conditions (temperature, inducer concentration, duration)

    • Consider fusion with rapidly folding partners like GFP to improve folding kinetics

  • Solubilization and Extraction:

    Detergent ClassExamplesAdvantagesLimitations
    Non-ionicDDM, Triton X-100Mild, preserve protein-protein interactionsVariable extraction efficiency
    ZwitterionicLDAO, CHAPSBalance between extraction efficiency and mildnessCan disrupt some interactions
    IonicSDSHigh extraction efficiencyHighly denaturing
    AmphipolsA8-35Stabilize membrane proteins in solutionExpensive, complex protocols
    NanodiscsMSP systemsNative-like lipid environmentComplex assembly process
  • Purification Strategy Optimization:

    • Two-step purification combining affinity chromatography with size exclusion

    • On-column detergent exchange to improve stability

    • Addition of lipids during purification to maintain native environment

    • Use of stabilizing additives (glycerol, specific ions, cholesterol)

  • Quality Control Methods:

    • Circular dichroism to assess secondary structure integrity

    • Fluorescence-based thermal shift assays to measure stability

    • Dynamic light scattering to assess homogeneity

    • Limited proteolysis to evaluate folding quality

  • Alternative Expression Systems:

    • Cell-free expression with added microsomes or nanodiscs

    • Yeast expression in Pichia pastoris for high-density culture

    • Specialized bacterial strains like C41(DE3) or C43(DE3) designed for membrane proteins

These technical approaches should be tailored based on downstream applications, whether structural studies requiring high purity or functional assays where native conformation is paramount. The successful expression and analysis of recombinant bat coronavirus proteins, as demonstrated in the synthetic recombinant bat SARS-like coronavirus studies , provides proof of concept for overcoming these challenges.

How can researchers interpret conflicting results about M protein functions across different coronavirus strains?

Reconciling contradictory findings requires systematic analytical approaches:

  • Context-Dependent Function Analysis:

    • Evaluate cellular context differences (cell types, expression levels)

    • Assess viral genetic background differences (accessory proteins present)

    • Consider host species factors that might interact differently with M proteins

    • Analyze experimental conditions (temperature, pH, ionic strength)

  • Structural-Functional Correlation:

    • Map conflicting results to specific domains or residues

    • Perform comparative sequence analysis to identify strain-specific features

    • Use structural modeling to predict how sequence differences affect function

    • Similar approaches helped resolve conflicting results in Spike protein studies

  • Methodological Reconciliation Framework:

    Conflict TypeAnalysis ApproachResolution Strategy
    Protein-protein interactionsCompare detection methods (Y2H vs Co-IP vs FRET)Validate with orthogonal methods in identical conditions
    Subcellular localizationAnalyze tagging strategies and expression levelsUse multiple tagging approaches and native antibodies
    Phenotypic effectsCompare virus backgrounds and cell typesTest in consistent genetic backgrounds across strains
    Biochemical propertiesEvaluate purification methods and buffer conditionsStandardize conditions or test across variable conditions
  • Meta-analysis Approaches:

    • Systematic review of methodologies used across studies

    • Statistical assessment of effect sizes rather than binary outcomes

    • Identification of moderator variables explaining discrepancies

    • Development of unified models accommodating strain-specific behaviors

  • Standardization Initiatives:

    • Use of common reference strains across laboratories

    • Development of standardized assays for key M protein functions

    • Creation of shared reagent repositories for comparative studies

When interpreting conflicting data, researchers should consider that the M protein may have evolved strain-specific functions or regulatory mechanisms that reflect adaptation to different host environments. This evolutionary context provides a framework for understanding functional divergence while maintaining core structural roles .

What methodological approaches can detect subtle functional differences between wild-type and mutant M proteins?

Detecting fine functional differences requires sensitive methodological approaches:

  • High-Resolution Phenotypic Assays:

    • Competition assays where wild-type and mutant viruses replicate in the same culture

    • Deep sequencing to track mutant frequencies over multiple passages

    • Single-cell analysis techniques to detect cell-to-cell variation in viral protein function

    • Similar approaches detected subtle functional differences in recombinant bat coronavirus Spike variants

  • Quantitative Interaction Mapping:

    • Surface plasmon resonance (SPR) for kinetic and affinity measurements

    • Microscale thermophoresis (MST) for solution-based interaction analysis

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • FRET/BRET-based assays for real-time interaction monitoring in living cells

  • Advanced Microscopy Techniques:

    • Single-molecule tracking to monitor diffusion and clustering behavior

    • Super-resolution microscopy (PALM/STORM) to visualize nanoscale organization

    • Correlative light and electron microscopy (CLEM) linking function to ultrastructure

    • Fluorescence fluctuation spectroscopy to measure oligomerization states

  • Systems Biology Approaches:

    • Transcriptome analysis to detect differential host responses

    • Proteomics to identify altered interaction networks

    • Lipidomics to assess membrane composition changes

    • Metabolomics to evaluate energetic consequences of mutations

  • Computational Analysis Methods:

    • Molecular dynamics simulations to predict structural consequences

    • Network analysis of protein-protein interaction changes

    • Machine learning approaches to integrate multiple data types

    • Similar computational approaches helped predict functional outcomes of mutations in the Spike protein

These approaches should ideally be applied in combination, as multifaceted analysis increases confidence in detecting subtle phenotypes. When designing mutational studies, it's important to include positive controls (mutations with known effects) and titration series (mutations with varying degrees of effect) to calibrate assay sensitivity.

How can researchers effectively study the evolutionary dynamics of M proteins in bat coronavirus populations?

Studying evolutionary dynamics requires integrating field-based and experimental approaches:

  • Field Surveillance and Sampling Strategies:

    • Longitudinal sampling of bat populations to track virus evolution

    • Nested sampling designs capturing geographic and host species variation

    • Non-invasive sampling methods to increase sample sizes ethically

    • Metagenomic approaches to detect rare variants

  • Sequence Analysis Methods:

    • Bayesian evolutionary analysis to reconstruct phylogenetic relationships

    • Selection pressure analysis using dN/dS ratios at codon level

    • Identification of co-evolving sites using mutual information analysis

    • Recombination detection using bootscanning and phylogenetic incongruence

    • These approaches can parallel those used for Spike protein evolution studies

  • Experimental Evolution Systems:

    • Serial passage experiments in different cell types to simulate host switching

    • Deep mutational scanning to map fitness landscapes

    • Directed evolution with selective pressure to identify adaptive pathways

    • Ancestral sequence reconstruction and resurrection

  • Structural Context Integration:

    Evolutionary MetricStructural InterpretationFunctional Implication
    Conservation scoresMapping to 3D structureIdentification of functional constraints
    Positive selection sitesSurface accessibility analysisPotential host adaptation sites
    Co-evolving residuesNetwork analysisFunctional interaction networks
    Lineage-specific changesHomology model comparisonClade-specific functional divergence
  • Coronavirus-Specific Analytical Considerations:

    • Account for high recombination rates in coronavirus evolution

    • Consider convergent evolution in independent lineages

    • Analyze epistatic interactions between M protein and other viral proteins

    • Evaluate host-specific selection pressures across bat species

When conducting evolutionary studies, researchers should integrate findings from laboratory-based functional studies with natural sequence variation to develop comprehensive models of evolutionary constraints. This approach has proven successful in understanding the evolution of other coronavirus proteins and can be applied to M protein research .

What are the most promising therapeutic approaches targeting the M protein of bat coronaviruses?

Several therapeutic strategies show potential for targeting coronavirus M proteins:

  • Small Molecule Inhibitors:

    • High-throughput screening can identify compounds disrupting M protein interactions

    • Structure-based drug design targeting conserved functional sites

    • Repurposing of existing antivirals that might have secondary effects on M protein

    • Development pipeline would parallel approaches used for other viral targets

  • Peptide-Based Inhibitors:

    • Design of peptides mimicking interaction interfaces to competitively inhibit assembly

    • Stapled peptides to improve stability and cellular uptake

    • Cell-penetrating peptides fused to functional blocking domains

    • Screening methods include phage display and peptide arrays

  • Oligonucleotide-Based Approaches:

    • siRNA targeting conserved regions of M protein mRNA

    • Antisense oligonucleotides to block translation

    • CRISPR-Cas13 systems for RNA targeting

    • Delivery systems including lipid nanoparticles or viral vectors

  • Immunological Interventions:

    • Monoclonal antibodies targeting exposed epitopes of M protein

    • Design of immunogens presenting conserved M protein epitopes

    • T-cell based therapies targeting conserved M protein peptides presented by MHC

    • Similar approaches have proven effective against other coronavirus proteins

  • Combination Therapies:

    • M protein inhibitors combined with entry inhibitors

    • Targeting multiple viral proteins simultaneously to reduce resistance

    • Host-directed therapies combined with direct-acting antivirals

When developing M protein-targeted therapeutics, considerations include genetic barrier to resistance, breadth of activity across coronavirus strains, and pharmacokinetic properties. While the M protein has received less attention than the Spike protein as a therapeutic target, its high conservation and essential functions make it potentially valuable for broad-spectrum coronavirus therapeutics.

How might future technologies enhance our ability to study recombinant bat coronavirus M proteins?

Emerging technologies promise to revolutionize M protein research:

  • Advanced Structural Biology Methods:

    • Cryo-electron tomography of intact virions at near-atomic resolution

    • Micro-electron diffraction (MicroED) for membrane protein crystals

    • Integrative structural biology combining multiple data sources

    • Mass photometry for single-molecule mass measurements

    • These approaches could provide structural insights similar to those achieved for the SARS-CoV-2 Spike protein

  • Artificial Intelligence Applications:

    • Deep learning for protein structure prediction specifically trained on membrane proteins

    • Machine learning algorithms to predict protein-protein interaction networks

    • Neural networks for design of optimized recombinant constructs

    • Natural language processing for automated literature mining and hypothesis generation

  • Synthetic Biology Advancements:

    • Cell-free expression systems optimized for membrane proteins

    • Expansion of the genetic code to incorporate non-canonical amino acids for probing

    • Minimal synthetic cells as simplified model systems

    • CRISPR-based platforms for high-throughput functional screening

    • These approaches build upon synthetic biology methods used to create recombinant bat coronaviruses

  • Single-Cell Technologies:

    • Single-cell transcriptomics to evaluate cell-specific responses to M protein variants

    • Single-cell proteomics to map protein interaction networks

    • Spatial transcriptomics to visualize infection dynamics in tissues

    • Microfluidic platforms for single-virion analysis

  • Advanced Imaging Technologies:

    • Expansion microscopy for visualization of virion assembly

    • Label-free imaging modalities for native state observation

    • Volumetric biosensors to monitor protein interactions in real time

    • Light sheet microscopy for whole-tissue imaging of infection

These technologies will enable increasingly sophisticated analyses of M protein structure, function, and interactions, potentially revealing new targets for therapeutic intervention and deeper understanding of coronavirus biology. Integration of multiple technological approaches will be key to comprehensive characterization of this essential viral protein.

How can integrative approaches better elucidate the role of M proteins in coronavirus cross-species transmission?

Understanding M protein's role in zoonosis requires multidisciplinary integration:

  • Integrative Genomics Framework:

    • Combining viral genomics with host transcriptomics

    • Correlating M protein sequence features with host range

    • Network analysis linking M protein evolution to other viral proteins

    • Comparative genomics across multiple bat species and human coronaviruses

  • Multi-Scale Structural Biology:

    • Linking atomic-level structural features to virion morphology

    • Identifying structural adaptations associated with host switching

    • Characterizing conformational dynamics under different conditions

    • Structural studies have been valuable for understanding Spike protein adaptation

  • Systems Virology Approaches:

    • Global proteomic analysis of virus-host protein interactions

    • Transcriptional profiling of host response to M protein variants

    • Metabolic profiling to identify host pathways engaged by different M proteins

    • Construction of predictive models of cross-species compatibility

  • Field-to-Laboratory Pipeline:

    • Surveillance and sequencing from natural bat populations

    • Functional characterization of natural M protein variants

    • Experimental testing of transmission hypotheses

    • Validation in relevant model systems

    • This pipeline parallels successful approaches used for studying Spike protein evolution

  • Collaborative Research Network Model:

    • International coordination of bat coronavirus surveillance

    • Standardized protocols for functional characterization

    • Centralized databases integrating phenotypic and genetic data

    • Interdisciplinary teams combining virology, ecology, and computational biology

These integrative approaches can help develop predictive frameworks to identify bat coronaviruses with zoonotic potential based on M protein characteristics, complementing similar efforts focused on Spike proteins. The successful development of synthetic recombinant bat coronaviruses demonstrates the value of integrated approaches for understanding coronavirus biology and preparing for future pandemic threats .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.