Recombinant Bat coronavirus 133/2005 Non-structural protein 3d (3d)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag type, please inform us; we will prioritize its development.
Synonyms
3d; Non-structural protein 3d; ns3d; Accessory protein 3d
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Bat coronavirus 133/2005 (BtCoV) (BtCoV/133/2005)
Target Names
3d
Target Protein Sequence
MAFSASLFRTKTVHTEDALCPRSAIQAEQPPNIIDCIPVAGYEAALVTNALFLLVLFVFN PLTCKGNWIKAILFYSLLLYNMILAIFLVIDTQHFVSALLLAYVVTFLILWTADRVRLSC AVGSVLPFVDMRSSYIRVDNGNSSVVVPMNHTKHWFIRNFEQSCHCENCFYIHSSSYVEC TFISRLKKSILVSVCDFSLGGNVSTVFVPSSDKTVPLHIIAPSKLYV
Uniprot No.

Target Background

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Bat coronavirus 133/2005 Non-structural protein 3d (3d)?

Recombinant Bat coronavirus 133/2005 Non-structural protein 3d (3d) is a specific protein component derived from a bat coronavirus strain identified in 2005. The protein is classified as a non-structural protein, meaning it is involved in viral replication and pathogenesis but is not incorporated into the viral particle structure . The full amino acid sequence consists of 227 amino acids: MAFSASLFRTKTVHTEDALCPRSAIQAEQPPNIIDCIPVAGYEAALVTNALFLLVLFVFNPLTCKGNWIKAILFYSLLLYNMILAIFLVIDTQHFVSALLLAYVVTFLILWTADRVRLSCAVGSVLPFVDMRSSYIRVDNGNSSVVVPMNHTKHWFIRNFEQSCHCENCFYIHSSSYVECTFISRLKKSILVSVCDFSLGGNVSTVFVPSSDKTVPLHIIAPSKLYV . This protein is available as a recombinant product for research applications, typically supplied in a Tris-based buffer with 50% glycerol optimized for stability .

How does Bat coronavirus 133/2005 relate to other bat coronaviruses in phylogenetic studies?

Bat coronavirus 133/2005 belongs to a diverse group of SARS-related coronaviruses (SARSr-CoVs) that have been detected in horseshoe bats since 2005 across various regions in China . Phylogenetic analyses have revealed that these bat SARSr-CoVs show sequence variations from the human SARS coronavirus (SARS-CoV) in multiple genes, including the S (spike), ORF8, and ORF3 regions . Comprehensive studies of bat coronavirus diversity have established evolutionary relationships through genome sequencing of hundreds of specimens. For instance, research conducted between 2010 and 2015 involved creating a "family tree" of coronaviruses carried by bats, identifying that coronaviruses found in Rhinolophus bats shared up to 96.2% sequence identity with SARS-CoV-2 . The Rhinolophus genus (Chinese horseshoe bats) has been identified as a major reservoir for SARS-related coronaviruses through phylogeographic and evolutionary analyses .

What experimental techniques are commonly used to study non-structural proteins like 3d?

The study of non-structural proteins like the 3d protein from Bat coronavirus 133/2005 typically employs a multi-faceted approach combining molecular, structural, and functional analyses. The primary techniques include recombinant protein expression in various systems (bacterial, insect, or mammalian cells), followed by purification through chromatography techniques . Functional characterization often involves enzymatic assays, crystallography for structure determination, and interaction studies with potential cellular targets. For coronavirus non-structural proteins, researchers commonly utilize ELISA-based assays to detect protein-protein interactions or to assess antibody responses . Additionally, reverse genetics systems, as demonstrated in studies of synthetic recombinant bat SARS-like coronaviruses, allow for the manipulation of viral genomes to study the role of specific proteins in replication and pathogenesis . In these systems, genomic cDNA fragments are synthesized, assembled into full-length cDNA, and transcribed in vitro to produce functional viral RNA .

How can researchers design experiments to evaluate the role of Bat coronavirus 133/2005 non-structural protein 3d in viral replication?

Designing experiments to evaluate the role of non-structural protein 3d in viral replication requires a sophisticated reverse genetics approach. Researchers can employ a methodology similar to that used for synthetic recombinant bat SARS-like coronavirus studies, where consensus genomic sequences are established and specific modifications are made to target genes of interest . This approach begins with designing a consensus genomic sequence based on available sequences from databases, followed by commercial synthesis of genomic cDNA fragments aligned with existing reverse genetics systems .

To specifically evaluate the role of protein 3d, researchers would create mutant constructs with deletions, substitutions, or functional motif alterations in the 3d coding region. Following the assembly of full-length cDNA and in vitro transcription to yield genomic RNA, these constructs would be electroporated into susceptible cell lines . Successful replication can be monitored through detection of leader-containing subgenomic transcripts, while viral protein expression can be assessed using specific antibodies against the 3d protein or other viral markers . Comparative analyses between wild-type and mutant constructs would reveal the impact of 3d protein modifications on viral replication kinetics, providing insights into its functional significance.

What methodological approaches can be used to assess potential interactions between bat coronavirus non-structural proteins and human cellular components?

Assessing interactions between bat coronavirus non-structural proteins like 3d and human cellular components requires multiple complementary methodologies. Initial screening can be performed using yeast two-hybrid systems or co-immunoprecipitation assays followed by mass spectrometry to identify potential interacting partners. For verification of specific interactions, researchers can utilize biolayer interferometry, surface plasmon resonance, or microscale thermophoresis to determine binding kinetics and affinity parameters.

Cell-based assays provide more physiologically relevant contexts for these interactions. Researchers can transfect human cell lines with constructs expressing the 3d protein tagged with fluorescent or affinity markers, followed by subcellular localization studies using confocal microscopy . To assess functional consequences of these interactions, CRISPR-Cas9 gene editing can be employed to knock out or modify potential human cellular targets, followed by infection with recombinant viruses expressing the 3d protein. Changes in viral replication efficiency, cellular response pathways, or cytopathic effects would indicate functional relevance of the identified interactions . Additionally, protein structural studies using X-ray crystallography or cryo-electron microscopy can provide atomic-level details of these interactions, informing rational drug design efforts.

How can researchers address the challenges in translating findings from bat coronavirus studies to predict potential zoonotic transmission risks?

Addressing translational challenges between bat coronavirus studies and zoonotic risk prediction requires integrated approaches combining molecular virology, ecology, and epidemiology. A fundamental approach involves receptor usage studies, wherein researchers can assess the ability of recombinant spike proteins containing receptor-binding domains from bat coronaviruses to interact with human ACE2 receptors . For example, studies have demonstrated that replacing the receptor-binding domain (RBD) of a bat SARS-like coronavirus with that from human SARS-CoV can create chimeric viruses (e.g., Bat-SRBD) capable of infecting human cells .

Pseudotyped virus systems offer a safer alternative to working with infectious viruses, allowing researchers to study entry mechanisms without handling fully infectious agents. Additionally, organoid models derived from human respiratory epithelia provide physiologically relevant systems to assess viral tropism and replication potential . For robust risk assessment, researchers should conduct comparative genomic analyses across diverse bat coronavirus strains, identifying adaptive mutations that might facilitate host switching. Machine learning algorithms can be applied to viral sequence data to predict zoonotic potential based on patterns observed in known human-infecting viruses . Finally, longitudinal surveillance of bat populations combined with serological studies in human communities with high bat-human contact provides ecological context for laboratory findings and may offer early warnings of spillover events .

What are the critical considerations for designing recombinant protein expression systems for Bat coronavirus 133/2005 non-structural protein 3d?

Successful expression of Recombinant Bat coronavirus 133/2005 non-structural protein 3d requires careful optimization of several key parameters. First, researchers must select an appropriate expression system based on the protein's characteristics and experimental requirements. While bacterial systems (typically E. coli) offer high yields and simplicity, mammalian or insect cell expression systems may provide better folding and post-translational modifications for coronavirus proteins that require such modifications for functionality .

Codon optimization for the chosen expression host is essential, as suboptimal codon usage can drastically reduce expression levels. For the 227-amino acid sequence of protein 3d, researchers should design synthetic genes with optimized codons while maintaining the native amino acid sequence . The choice of purification strategy is another critical consideration, with most protocols employing affinity tags such as 6xHis, GST, or FLAG for initial capture. The positioning of these tags (N-terminal vs. C-terminal) should be evaluated empirically, as they may affect protein folding or function . Buffer composition significantly impacts protein stability and activity; the optimal buffer for protein 3d contains Tris with 50% glycerol to prevent aggregation and maintain functionality during storage . Finally, researchers must validate the expressed protein through multiple methods, including SDS-PAGE, Western blotting with specific antibodies, and functional assays appropriate to the known or predicted activities of the 3d protein.

How can researchers optimize cell-based assays to evaluate the impact of bat coronavirus non-structural proteins on cellular pathways?

Optimizing cell-based assays for evaluating the impact of bat coronavirus non-structural proteins requires systematic consideration of multiple variables. Cell line selection is paramount; human respiratory epithelial cell lines (like Calu-3) or primary airway cells provide physiologically relevant contexts, while Vero E6 or Huh-7 cells are commonly used for their high susceptibility to coronavirus infection . For studies specifically focused on protein 3d, researchers should establish stable cell lines with inducible expression systems allowing tight regulation of protein expression levels.

Assay design should incorporate multi-parameter readouts to capture the complexity of cellular responses. This includes combining transcriptomic approaches (RNA-seq or targeted RT-qPCR panels) with proteomic analyses and functional assays measuring specific pathway activities . Time-course experiments are essential, as cellular responses to viral proteins often exhibit dynamic changes that single time-point measurements might miss. Control experiments must include appropriate vector-only controls and, when possible, mutant versions of the 3d protein with altered functional domains to establish causality between specific protein features and observed cellular effects .

For pathway-specific analyses, researchers can employ reporter constructs with promoter elements responsive to specific transcription factors (e.g., NF-κB, IRF3, or STAT1/2) to measure the impact of protein 3d on innate immune signaling pathways. Complementary approaches include phospho-specific Western blotting to detect activation of signaling cascades and subcellular fractionation to track changes in protein localization in response to 3d expression .

What statistical approaches are most appropriate for analyzing comparative studies between bat coronavirus proteins and human SARS-CoV proteins?

Statistical analysis of comparative studies between bat coronavirus proteins and human SARS-CoV proteins requires rigorous approaches tailored to the specific data types. For sequence-based comparisons, phylogenetic analyses using maximum likelihood or Bayesian inference methods provide statistical frameworks for assessing evolutionary relationships . When comparing multiple sequences, researchers should calculate percent identity matrices across functional domains rather than whole proteins, as functional constraints often result in domain-specific conservation patterns .

When analyzing complex datasets from high-throughput experiments (e.g., transcriptomics or proteomics), dimension reduction techniques such as principal component analysis or t-SNE help visualize patterns in multidimensional data. Multiple testing correction (e.g., Benjamini-Hochberg procedure) is essential to control false discovery rates when making numerous statistical comparisons . For integrating data across multiple experimental approaches, researchers should consider hierarchical clustering or network analyses to identify coherent patterns that may not be apparent in individual datasets. Finally, whenever possible, validation of key findings through independent experimental approaches strengthens statistical inferences and reduces the risk of artifacts from specific methodologies.

How should researchers interpret recombination events identified in bat coronavirus genomes when assessing evolutionary origins?

Interpretation of recombination events in bat coronavirus genomes requires careful consideration of both methodological and biological factors. Researchers should employ multiple detection methods, including similarity plot analyses, bootscanning, and phylogenetic incongruence tests, as each has different sensitivities and specificities for recombination detection . Statistical evaluation of identified recombination breakpoints is essential, with methods like the PHI-test or maximum chi-square test providing p-values for the significance of recombination signals.

When interpreting identified recombination events, researchers must distinguish between ancient and recent recombination by examining the distribution of synonymous mutations across putative recombinant regions. Frequent recombination events within specific genomic regions, such as those observed within the S gene and around ORF8 in SARS-related coronaviruses, may indicate these regions are recombination hotspots deserving special attention . The functional implications of recombination should be assessed by examining whether breakpoints coincide with protein domain boundaries, suggesting selection for functional recombinant proteins.

The ecological context of recombination is equally important for interpretation. Co-circulation of multiple coronavirus strains within the same bat populations provides opportunities for recombination, as demonstrated by the discovery of diverse SARS-related coronaviruses within single cave locations . When reconstructing the evolutionary history of human-infecting viruses like SARS-CoV, researchers should consider sequential recombination events between bat coronavirus lineages as a potential pathway for emergence, rather than simple linear evolution . This perspective is supported by evidence that the direct progenitor of SARS-CoV may have originated through such sequential recombination events between precursors of SARS-related coronaviruses circulating in bat populations.

How can structural information about Bat coronavirus 133/2005 non-structural protein 3d inform antiviral drug development?

Structural information about the Bat coronavirus 133/2005 non-structural protein 3d can significantly advance antiviral drug development through multiple approaches. Detailed structural characterization through X-ray crystallography, nuclear magnetic resonance spectroscopy, or cryo-electron microscopy can reveal potential druggable pockets not immediately evident from sequence analysis alone. These structural insights enable structure-based virtual screening of compound libraries to identify potential inhibitors targeting specific functional domains of the protein.

Comparative structural analyses between bat coronavirus 3d protein and homologous proteins from human-infecting coronaviruses can identify conserved features that might serve as broad-spectrum antiviral targets . This approach is particularly valuable given evidence that antibody and antiviral drug therapies developed for COVID-19 might be effective against other bat-origin coronaviruses that use similar cellular entry mechanisms . Structure-function studies combining mutagenesis with activity assays can identify critical residues for protein function, providing focal points for inhibitor design.

Fragment-based drug discovery approaches, where small chemical fragments are screened for binding to the protein structure, can yield chemical starting points for medicinal chemistry optimization. For non-structural protein 3d, researchers should particularly focus on regions involved in protein-protein interactions or enzymatic activities essential for viral replication . Additionally, allosteric sites identified through structural studies often provide opportunities for developing inhibitors with novel mechanisms of action and potentially higher barriers to resistance development.

What research directions should be prioritized to better understand the zoonotic potential of bat coronaviruses containing proteins similar to non-structural protein 3d?

To better understand the zoonotic potential of bat coronaviruses containing proteins similar to non-structural protein 3d, several research directions should be prioritized. First, expanded surveillance efforts across diverse bat populations should aim to characterize the full genetic diversity of circulating coronaviruses, with particular attention to non-structural proteins that may influence host range and virulence . Comparative functional studies of non-structural proteins from different bat coronavirus lineages can identify specific molecular features associated with effective replication in human cells.

Experimental evolution studies, where bat coronaviruses are passaged in human cell cultures or humanized animal models, can identify adaptive mutations that enhance fitness in human hosts, providing markers for surveillance of high-risk viral variants . Development of improved physiologically relevant models, such as human airway organoids or lung-on-chip platforms, would provide systems that better recapitulate the complexity of human respiratory epithelia for evaluating virus-host interactions .

Integrative approaches combining genomics, structural biology, and functional studies should focus on understanding how non-structural proteins like 3d interact with host cell machinery . Particular attention should be paid to proteins involved in antagonizing innate immune responses or modifying cellular processes to favor viral replication. Finally, development of broadly protective vaccines and antivirals targeting conserved features across diverse bat coronaviruses would strengthen preparedness for future emergence events, as demonstrated by findings that existing COVID-19 therapeutic approaches might provide cross-protection against newly identified bat coronaviruses with similar cellular entry mechanisms .

What are the major technical challenges in expressing and purifying functional Recombinant Bat coronavirus 133/2005 non-structural protein 3d?

The expression and purification of functional Recombinant Bat coronavirus 133/2005 non-structural protein 3d presents several technical challenges that researchers must address. Protein solubility is a primary concern, as viral proteins often form inclusion bodies in bacterial expression systems. To overcome this, researchers can optimize expression conditions (temperature, induction time, and inducer concentration) or employ solubility-enhancing fusion partners such as MBP, SUMO, or thioredoxin . For proteins that remain insoluble, denaturation-refolding protocols using chaotropic agents followed by controlled dilution or dialysis can be attempted, though these often result in lower yields of properly folded protein.

Confirming proper folding and functionality of the purified protein is essential but challenging without established activity assays. Circular dichroism spectroscopy can provide information about secondary structure content, while limited proteolysis combined with mass spectrometry can indicate whether the protein has a compact, folded structure. For functional validation, researchers might need to develop custom assays based on predicted activities or interaction partners of the 3d protein . Finally, batch-to-batch consistency remains a challenge for reproducible research; implementing rigorous quality control measures including SDS-PAGE, size-exclusion chromatography, and activity assays for each preparation helps ensure consistent experimental results.

How can researchers overcome limitations in studying bat coronaviruses that cannot be cultured in laboratory settings?

Studying bat coronaviruses that cannot be cultured presents significant methodological challenges requiring innovative approaches. Synthetic genomics techniques offer a powerful solution, as demonstrated in studies where consensus viral genomes were designed based on sequences from multiple field isolates, followed by de novo synthesis and assembly of genomic cDNA fragments . This approach allows researchers to reconstruct uncultivable viruses and study their replication machinery without isolating the original virus.

Reverse genetics systems enable the creation of chimeric viruses, where specific genes or domains from uncultivable bat coronaviruses are introduced into cultivable backbone viruses. For example, replacing the receptor-binding domain of a bat SARS-like coronavirus with that from SARS-CoV created a chimeric virus (Bat-SRBD) that could infect cells expressing human ACE2 . These chimeric viruses allow focused study of specific viral components within a replication-competent system.

Pseudotyped virus systems, where viral entry proteins (like the spike protein) are expressed on the surface of replication-defective viral particles, permit the study of entry mechanisms without requiring the full virus to be cultured . For studying non-structural proteins like 3d, individual protein expression in relevant cell types can reveal effects on cellular pathways even in the absence of full viral replication .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.