Recombinant Bat coronavirus 279/2005 Membrane protein (M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Bat coronavirus 279/2005 (BtCoV) (BtCoV/279/2005)
Target Names
M
Target Protein Sequence
MTDNGTITVEELKQLLEQWNLVIGFIFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVT LACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNPETNILLN VPLRGTILTRPLLESELVIGAVIIRGHLRMAGHSLGRCDIKDLPKEITVATSRTLSYYKL GASQRVGNDSGFAAYNRYRIGNYKLNTDHSGSNDNIALLVQ
Uniprot No.

Target Background

Function
A viral envelope component crucial for virus morphogenesis and assembly through interactions with other viral proteins.
Protein Families
Betacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the Membrane (M) protein in bat coronaviruses and what is its function?

The Membrane (M) protein is one of the four main structural proteins in coronaviruses, including bat coronaviruses. The M protein is an integral membrane protein that plays essential roles in viral assembly and morphogenesis. Along with the Envelope (E) protein, it defines the shape of the viral envelope . The M protein interacts with other structural proteins, particularly the nucleocapsid (N) protein, to facilitate the packaging of the viral genome into virions. This protein is relatively conserved across coronaviruses compared to the Spike (S) protein, making it a potential target for broad-spectrum antiviral strategies.

In bat coronaviruses specifically, the M protein maintains similar structural characteristics to other coronaviruses while potentially containing unique features that may influence host adaptation. Research indicates that the coronavirus M protein contains three transmembrane domains and is responsible for most protein-protein interactions required during viral assembly .

What methods are used to identify and characterize novel bat coronaviruses?

Identification and characterization of novel bat coronaviruses typically involve a multi-step approach:

  • Sample Collection: Researchers collect fecal, anal, or respiratory swabs from wild bats. For example, in one surveillance study, 162 swab samples from 12 bat species were collected to identify novel coronaviruses .

  • RT-PCR Screening: Consensus primers targeting conserved regions (typically the RNA-dependent RNA polymerase gene) are used for initial screening. These primers are designed to cross-react with multiple coronavirus sequences .

  • Sequencing Confirmation: Positive PCR amplicons undergo DNA sequencing to characterize the viral genome fragments. Sequences can then be compared to known coronavirus sequences to determine phylogenetic relationships .

  • Cell Culture Isolation Attempts: Researchers attempt to isolate live viruses using various cell lines such as MDCK, FRhK4, and Vero E6 cells, though these attempts are often unsuccessful with novel bat coronaviruses .

  • Whole Genome Sequencing: For more complete characterization, researchers sequence key viral genes or the complete genome, focusing on regions like RdRp, S, E, M, and N genes .

When examining specific studies, investigators reported positive PCR results in 63% (12 of 19) of fecal samples from Miniopterus pusillus bats collected from three different geographical locations, demonstrating the effectiveness of these methods for viral surveillance .

How are recombinant bat coronavirus proteins expressed for research purposes?

Recombinant bat coronavirus proteins, including the M protein, are expressed using several methodologies tailored to the specific research goals:

  • Bacterial Expression Systems: For basic structural studies, the M protein or fragments may be expressed in bacterial systems like E. coli, often with affinity tags (e.g., His-tags) for purification. This approach was used to express the nucleocapsid protein of bat-SARS-CoV for serological studies, where (His)6-tagged recombinant N protein was produced using specifically designed primers and purified for Western blot analysis .

  • Mammalian Cell Expression: For functional studies requiring proper folding and post-translational modifications, mammalian expression systems (HEK293T, CHO cells) are preferred.

  • Synthetic Biology Approaches: Complete or partial viral genomes can be synthesized based on consensus sequences derived from field isolates. For example, researchers designed and synthesized a consensus Bat-SCoV genome by aligning sequences from four reported Bat-SCoVs (HKU3-1, HKU3-2, HKU3-3, and RP3) to study their infectivity and host range .

  • Reverse Genetics Systems: Specific mutations or chimeric constructs can be created to study protein function. In one study, scientists designed cDNA fragments with junctions precisely aligned to the existing SARS-CoV reverse genetics system to create synthetic bat coronaviruses .

For the M protein specifically, expression optimization often requires careful consideration of the hydrophobic transmembrane domains. Codon optimization, inducible promoters, and fusion partners may be employed to enhance expression levels and solubility.

What are the key challenges in expressing functional recombinant bat coronavirus M proteins?

Expressing functional recombinant bat coronavirus M proteins presents several significant challenges:

  • Membrane Protein Solubility: As an integral membrane protein, the M protein contains multiple transmembrane domains that make it inherently hydrophobic and difficult to express in soluble form. Researchers must employ specialized approaches for membrane protein expression, including:

    • Detergent optimization for extraction and purification

    • Use of nanodisc or liposome reconstitution systems

    • Creation of truncated constructs focusing on soluble domains

  • Proper Folding and Orientation: The M protein's functionality depends on correct folding and membrane orientation. Standard expression systems may not provide the necessary cellular machinery for proper insertion into membranes.

  • Post-translational Modifications: Bat coronavirus M proteins may require specific post-translational modifications that are only properly executed in mammalian or insect cell systems, not in bacterial expression systems.

  • Cytotoxicity: Expression of viral membrane proteins can cause cytotoxicity to host cells, limiting yield and requiring tightly regulated inducible expression systems.

  • Species-Specific Factors: When expressing bat viral proteins, species-specific factors that might be required for proper folding or function may be absent in conventional expression systems.

For coronavirus structural protein expression, researchers have found success using approaches similar to those used for the nucleocapsid protein, where specific primers (e.g., 5′-CGCGGATCCGATGTCTGATAATGGACCC-3′ and 5′-CGGAATTCTTATGCCTGAGTAGAATCA-3′) were employed to amplify the target gene, followed by expression and purification for further analysis .

How can synthetic recombinant bat coronaviruses be designed to study interspecies transmission potential?

Designing synthetic recombinant bat coronaviruses to study interspecies transmission potential involves sophisticated approaches that focus on specific viral components:

  • Receptor Binding Domain (RBD) Exchange: The Spike protein's RBD is critical for determining host range. By replacing the bat coronavirus RBD with that of human-adapted viruses (or vice versa), researchers can assess transmission potential. For example, scientists replaced the Bat-SCoV RBD (amino acids 323-505) with the SARS-CoV RBD (amino acids 319-518) to create a chimeric virus (Bat-SRBD) that could efficiently infect human cells, demonstrating how such exchanges might facilitate zoonotic transmission .

  • Consensus Genome Design: When multiple related bat coronavirus sequences are available, researchers create a consensus sequence representing the most likely functional genome. This approach was used to establish a putative consensus Bat-SCoV sequence from four reported Bat-SCoVs .

  • Systematic Domain Swapping: Beyond the RBD, researchers can create chimeras by exchanging other genomic regions to identify additional determinants of host range and pathogenicity.

  • Point Mutation Analysis: Specific amino acid changes can be introduced to test hypotheses about adaptation. The Y436H substitution in the Spike RBD was incorporated into Bat-SRBD to create Bat-SRBD-MA, which demonstrated enhanced replication in mice, supporting the role of this mutation in host adaptation .

  • Transcriptional Regulatory Sequence Adaptation: For recombinant viral systems, the defined and functional transcriptional regulatory sequences must be carefully selected to ensure viral gene expression. Researchers used SARS-CoV 5' UTR and transcriptional regulatory sequences when constructing synthetic bat coronaviruses because the bat coronavirus 5' UTRs were incomplete in field samples .

These approaches have revealed key insights, including that the CoV Spike RBD is interchangeable between bat and human coronaviruses and is sufficient to confer efficient growth and infectivity in cells from multiple species, representing a critical determinant of transspecies movement of zoonotic CoVs .

What analytical methods are used to compare M proteins from different bat coronavirus strains?

Researchers employ multiple analytical methods to compare M proteins from different bat coronavirus strains:

  • Sequence Alignment and Phylogenetic Analysis: Primary structure comparison identifies conserved and variable regions. Multiple sequence alignment tools (MUSCLE, CLUSTALW) followed by phylogenetic tree construction help determine evolutionary relationships.

  • Structural Prediction and Modeling: Given the limited experimental structures for coronavirus M proteins, computational approaches predict secondary and tertiary structures. Tools like PSIPRED for secondary structure and homology modeling with Rosetta or I-TASSER for tertiary structure are commonly employed.

  • Domain Conservation Analysis: Researchers analyze specific functional domains across strains, including:

    • Transmembrane domains

    • Cytoplasmic tail regions

    • Protein-protein interaction motifs

  • Post-translational Modification Prediction: Comparison of predicted glycosylation, phosphorylation, and other modifications provides insights into functional differences.

  • Hydrophobicity Profile Analysis: As membrane proteins, M protein function depends on hydrophobic properties. Kyte-Doolittle plots help compare membrane integration potential across strains.

  • Epitope Mapping and Antigenicity Prediction: Computational tools predict antigenic regions to compare immunological properties between different bat coronavirus M proteins.

How can recombinant M protein be used to develop serological assays for bat coronaviruses?

Recombinant M protein can be utilized for developing sensitive and specific serological assays for bat coronavirus detection through the following methodologies:

  • Recombinant Protein Production: The M protein (or immunogenic fragments) is expressed in suitable systems, purified, and used as antigen in assays. While not specifically for M protein, a similar approach was demonstrated for the nucleocapsid protein, where (His)6-tagged recombinant protein was successfully used for serological analysis .

  • ELISA Development:

    • Direct ELISA: Recombinant M protein is coated onto plates to capture anti-M antibodies from bat serum samples

    • Indirect ELISA: M protein-specific antibodies are used to detect viral proteins in samples

    • Competitive ELISA: For increased specificity in distinguishing between related coronaviruses

  • Western Blot Confirmation: Recombinant M protein can serve as a target antigen in Western blot assays for confirming ELISA results. This approach has been successfully used with bat coronavirus nucleocapsid protein, where Western blot analysis using 900 ng of purified (His)6-tagged protein and sera at 1:1,000 dilution provided reliable detection of antibody responses .

  • Multiplex Serological Platforms: Multiple recombinant coronavirus proteins, including M, N, and S, can be incorporated into bead-based multiplex assays for comprehensive antibody profiling.

  • Evaluation of Cross-Reactivity: Critical testing includes:

    • Cross-absorption studies to remove antibodies reacting with related coronaviruses

    • Competitive binding assays to determine specificity

    • Testing against diverse coronavirus strain panels

In one study using recombinant nucleocapsid protein, antibodies against bat-SARS-CoV were detected in 84% of Chinese horseshoe bats using an enzyme immunoassay, demonstrating the effectiveness of recombinant viral proteins in serological surveillance . Similar approaches could be adapted for the M protein to develop assays with potentially complementary specificity profiles.

What strategies can optimize the expression and purification of recombinant bat coronavirus M protein?

Optimizing expression and purification of recombinant bat coronavirus M protein requires specialized strategies to address its hydrophobic nature and multiple transmembrane domains:

  • Expression System Selection:

    • Cell-Free Systems: Allow direct incorporation into artificial membranes during synthesis

    • Insect Cell Expression (Baculovirus): Provides high-yield membrane protein expression with eukaryotic processing

    • Mammalian Expression Systems: Offer native-like membrane composition and processing machinery

    • Methylotrophic Yeast (Pichia pastoris): Combines high yield with eukaryotic processing capability

  • Construct Optimization:

    • Fusion Tags: Incorporate solubility-enhancing tags (MBP, SUMO) at N- or C-terminus

    • Truncation Constructs: Express soluble domains separately when full-length expression is challenging

    • Codon Optimization: Adapt codons to expression host preferences

    • Signal Sequence Modification: Optimize membrane targeting and insertion

  • Expression Condition Optimization:

    • Induction Parameters: Lower temperatures (16-25°C) often improve membrane protein folding

    • Membrane-Mimetic Additives: Include lipids or mild detergents in culture media

    • Chemical Chaperones: Additives like glycerol can enhance proper folding

  • Extraction and Purification:

    • Detergent Screening: Systematic testing of detergents (DDM, LMNG, Digitonin) for optimal solubilization

    • Purification Strategy:

      • Two-step affinity chromatography followed by size exclusion

      • Batch purification methods to minimize protein aggregation

  • Reconstitution Methods:

    • Nanodiscs: Incorporation into nanodiscs for structural studies

    • Proteoliposomes: Reconstitution into liposomes for functional studies

While not specifically for M protein, successful expression strategies have been demonstrated for coronavirus structural proteins. For example, when expressing the nucleocapsid protein, researchers used carefully designed primers and a bacterial expression system with (His)6-tagging, which resulted in sufficient protein for immunological studies .

What cell culture systems are most effective for studying recombinant bat coronavirus infection and replication?

Several cell culture systems have been employed for studying recombinant bat coronavirus infection and replication, each with specific advantages:

  • Vero E6 Cells (African Green Monkey Kidney):

    • Most commonly used for coronavirus propagation

    • Support robust replication of SARS-CoV and recombinant bat-SARS-like coronaviruses

    • Deficient in type I interferon, allowing unimpeded viral replication

    • Successfully used to propagate Bat-SRBD virus with growth kinetics similar to SARS-CoV

  • Human Airway Epithelial (HAE) Cultures:

    • Physiologically relevant primary cell system representing natural infection site

    • Maintain native architecture and cell diversity of respiratory epithelium

    • Both SARS-CoV and Bat-SRBD replicated efficiently in HAE cultures, providing a direct human airway model for testing antivirals

  • ACE2-Expressing Cell Lines:

    • DBT (Delayed Brain Tumor) cells expressing human or civet ACE2 receptors

    • Allow study of receptor specificity across species

    • Bat-SRBD and SARS-CoV exhibited remarkably similar growth kinetics in DBT-hACE2 and DBT-cACE2 cells

    • Regular DBT cells lacking ACE2 expression did not support growth of either virus

  • Lung Cell Lines:

    • Calu-3 (human airway cells)

    • A549 (type II pneumocytes)

    • Provide insights into lower respiratory tract infection dynamics

  • Bat Cell Lines:

    • Limited availability but valuable for studying bat-specific host factors

    • May provide insights into natural host adaptation

Despite advances in cell culture systems, it's important to note that many wild-type bat coronaviruses remain difficult to isolate. For example, attempts to isolate novel bat coronavirus from Miniopterus species using MDCK, FRhK4, and Vero E6 cells were unsuccessful . This highlights the need for specialized approaches when working with novel bat coronaviruses, potentially including genetically modified cell lines expressing bat-specific receptors or immune factors.

What in vivo models are available for studying the pathogenesis of recombinant bat coronaviruses?

In vivo models for studying recombinant bat coronavirus pathogenesis range from natural host species to humanized models, each with distinct advantages:

  • Mouse Models:

    • Wild-type mice: Used for initial infection studies with recombinant coronaviruses

    • Aged BALB/c mice: More susceptible to coronavirus infection and pathogenesis

    • Transgenic hACE2 mice: Express human ACE2 receptor for studying SARS-like viruses

    • Mouse-adapted virus studies: The Y436H substitution in the Spike RBD of Bat-SRBD (creating Bat-SRBD-MA) enhanced viral replication in mice by approximately 1.5 logs compared to the non-adapted virus, demonstrating the utility of adapted viruses in mouse models

  • Syrian Golden Hamsters:

    • Develop more severe disease than mice

    • Support robust replication of SARS-CoV-like viruses

    • Show pathology similar to human cases

  • Ferrets:

    • Model for upper respiratory tract infection

    • Display clinical signs similar to humans

    • Used for transmission studies due to similar respiratory tract anatomy

  • Non-Human Primates:

    • Genetically and physiologically closest to humans

    • Several species used (macaques, African green monkeys)

    • Allow for detailed immunological studies

    • Most accurate model for testing therapeutic interventions

  • Bat Colonies:

    • Natural hosts provide insights into virus-host co-evolution

    • Study asymptomatic carriage and immune responses

    • Challenging for laboratory settings due to housing requirements

When evaluating in vivo models, studies have shown that while mice infected with chimeric bat coronaviruses like Bat-SRBD and Bat-SRBD-MA did not exhibit significant weight loss or morbidity, viral replication could be detected in the lungs. The mouse-adapted variant Bat-SRBD-MA replicated approximately 1.5 logs more efficiently at day 2 post-infection compared to Bat-SRBD, providing evidence that the Y436H substitution may improve mouse ACE2 receptor engagement .

For ethical and practical considerations, researchers employ a stepwise approach—starting with cell culture systems, then moving to mouse models, and finally to higher-order animal models only when necessary for specific research questions that cannot be addressed in simpler systems.

How do the structural and functional properties of bat coronavirus M proteins compare to those of human coronaviruses?

The structural and functional properties of bat coronavirus M proteins share fundamental similarities with human coronavirus M proteins, but with notable differences that may influence host adaptation:

FeatureBat Coronavirus M ProteinHuman Coronavirus M ProteinSignificance
Domain Architecture3 transmembrane domains with N-terminal ectodomain and C-terminal endodomainSimilar architecture across coronavirusesConserved structural organization reflects essential functions in viral assembly
SizeTypically 220-230 amino acidsSARS-CoV: 221 amino acids MERS-CoV: 219 amino acidsSimilar sizes reflect conserved functions
GlycosylationLimited N-linked glycosylation sitesSimilar pattern with some variations in site distributionMay affect immunogenicity and protein stability
Membrane TopologyTriple-pass transmembrane proteinSame topologyEssential for proper virus assembly
Protein InteractionsInteracts with N, E, and S proteinsSimilar interaction patternsCore component of viral assembly machinery
Sequence ConservationHigher conservation compared to S protein-Suggests functional constraints on evolution
Epitope DistributionMay contain bat-specific epitopesHuman coronavirus-specific epitopes identifiedImplications for cross-species immunity

Comparative analyses of bat and human coronavirus genomes have shown that most variations occur in the Spike genes, ORF3, and ORF8, whereas structural genes like M tend to be more conserved . This conservation suggests that the M protein's essential functions in viral assembly are maintained across species barriers, while host adaptation primarily occurs through alterations in the receptor-binding components of the virus.

What bioinformatic approaches are used to predict potential recombination events in bat coronavirus evolution?

Bioinformatic approaches for predicting potential recombination events in bat coronavirus evolution involve sophisticated computational methods:

  • Similarity Plot Analysis:

    • Tools like SimPlot and RDP4 detect changes in sequence similarity across viral genomes

    • Sliding window analyses identify regions with discordant phylogenetic signals

    • Enables visualization of potential recombination breakpoints

  • Phylogenetic Incongruence Methods:

    • Construction of separate phylogenetic trees for different genomic regions

    • Statistical tests for topological differences between trees (SH test, AU test)

    • Bootstrapping analyses to assess confidence in branching patterns

  • Breakpoint Detection Algorithms:

    • GARD (Genetic Algorithm for Recombination Detection)

    • BOOTSCAN analysis to identify shifts in phylogenetic clustering

    • Maximum Chi-Square method for detecting non-random clustering of sequence differences

  • Bayesian Inference Approaches:

    • BEAST framework with dedicated recombination detection extensions

    • Probabilistic assessment of recombination events throughout evolutionary history

    • Estimation of recombination timing and parental lineages

  • Whole Genome Comparison Tools:

    • Alignment visualization tools (e.g., MAFFT, Clustal Omega)

    • Dotplot analyses for detecting sequence rearrangements

    • BLAST-based approaches for identifying similar sequences in distantly related viruses

These approaches have revealed significant recombination events in coronavirus evolution. For example, analysis of bat SARS-like coronaviruses identified a 29-bp insertion in ORF8 of bat-SARS-CoV genome that was also present in civet SARS-CoV genomes but absent in most human SARS-CoV genomes, suggesting a common ancestor with civet SARS-CoV . This finding supports the hypothesis that recombination events played a role in the evolution of SARS-CoV.

Researchers have also used these methods to identify that most differences between bat-SARS-CoV and SARS-CoV genomes were concentrated in the Spike genes, ORF3, and ORF8, which are precisely the regions where most variations were observed between human and civet SARS-CoV genomes . This pattern suggests these regions may be hotspots for recombination events facilitating host adaptation.

What are the key considerations for designing experiments to study membrane protein interactions in coronavirus assembly?

Designing experiments to study membrane protein interactions in coronavirus assembly requires careful consideration of multiple factors:

  • Selection of Experimental Systems:

    • Cell-Free Reconstitution: Allows precise control over component concentrations

    • Mammalian Cell Culture: Provides native cellular environment with appropriate membranes

    • Yeast Two-Hybrid Adaptations: Modified for membrane protein interaction studies

    • Split-Reporter Systems: For detecting interactions in living cells

  • Protein Tagging Strategies:

    • Position Considerations: Tags must not disrupt transmembrane domains or interaction interfaces

    • Tag Selection: Smaller tags (FLAG, HA) for minimal interference

    • Verification: Multiple tag locations to confirm interactions

    • Cleavable Tags: For downstream structural studies

  • Co-Immunoprecipitation Approaches:

    • Detergent Selection: Critical for maintaining interactions while solubilizing membranes

    • Crosslinking Options: DSP, formaldehyde, or photo-activated crosslinkers

    • Sequential IP: For studying multi-protein complexes

    • Controls: Non-interacting membrane proteins as negative controls

  • Advanced Imaging Techniques:

    • FRET/BRET: For studying interactions in living cells

    • Proximity Ligation Assay: Detection of proteins within 40 nm distance

    • Super-Resolution Microscopy: Visualizing assembly sites at nanoscale resolution

    • Correlative Light-Electron Microscopy: Combining functional and structural information

  • Mass Spectrometry Approaches:

    • BioID or APEX Proximity Labeling: Identifying proteins in close proximity

    • Cross-linking Mass Spectrometry: Identifying specific interaction interfaces

    • Native Mass Spectrometry: For intact complex analysis

    • Sample Preparation: Specialized protocols for membrane protein complexes

  • Functional Validation:

    • Mutagenesis Studies: Targeting predicted interaction interfaces

    • Domain Swapping: Between related coronaviruses

    • Competitive Inhibition: Using peptides derived from interaction domains

    • Virus-Like Particle Assays: Quantifying assembly efficiency

When designing such experiments, researchers must consider the challenges unique to the coronavirus M protein, including its multiple transmembrane domains and the need to maintain native membrane environments. For example, when studying interactions between structural proteins, approaches similar to those used for nucleocapsid protein studies could be adapted, potentially using carefully designed constructs with appropriate tags for detection and purification .

How can recombinant bat coronavirus models contribute to pandemic preparedness?

Recombinant bat coronavirus models provide valuable tools for pandemic preparedness through multiple avenues:

  • Pre-Emergence Risk Assessment:

    • Synthetic recombinant viruses allow testing of theoretical recombination events that could lead to human adaptation

    • Chimeric viruses with different receptor binding domains help predict potential cross-species transmission events

    • Experimental evolution studies can identify mutations that enhance human cell infection

  • Diagnostic Development and Validation:

    • Recombinant viruses serve as safe reference materials for developing diagnostic tests

    • Allow pre-validation of molecular and serological assays before natural emergence

    • Enable development of broadly reactive diagnostics that can detect novel variants

  • Therapeutic Development:

    • Platform for testing antiviral drugs against potential pandemic strains

    • Screening of broad-spectrum antivirals effective against multiple bat coronaviruses

    • Both SARS-CoV and Bat-SRBD replicated efficiently in human airway epithelial cultures, providing a direct human airway model for comparison of existing and new antivirals

  • Vaccine Strategy Development:

    • Testing vaccine platforms against diverse coronavirus strains

    • Identification of conserved epitopes for broadly protective vaccines

    • Assessment of cross-protection between related coronaviruses

  • Understanding Viral Evolution:

    • Identifying genetic elements critical for cross-species transmission

    • The success in recovering Bat-SRBD (which includes the RBD from human SARS-CoV) demonstrated the plasticity of coronavirus glycoproteins and identified a necessary genetic element for coronavirus cross-species transmission

    • Establishing model systems for testing experimental evolution of zoonotic coronaviruses

  • Biosafety and Biosecurity Training:

    • Recombinant systems provide training opportunities for safe handling of high-consequence pathogens

    • Development of biosafety protocols for novel coronaviruses

The development of synthetic biology approaches for coronaviruses has demonstrated that rational design, synthesis, and recovery of hypothetical recombinant viruses can be used to investigate mechanisms of transspecies movement of zoonoses and has great potential to aid in rapid public health responses to known or predicted emerging microbial threats .

What emerging technologies might enhance our understanding of bat coronavirus membrane proteins?

Several emerging technologies promise to advance our understanding of bat coronavirus membrane proteins:

  • Cryo-Electron Microscopy Advancements:

    • Single-Particle Analysis: Achieving near-atomic resolution of membrane protein complexes

    • Cryo-Electron Tomography: Visualizing M proteins in their native viral envelope context

    • In Situ Structural Biology: Studying M protein organization within infected cells

    • Time-Resolved EM: Capturing dynamic assembly processes

  • Advanced Mass Spectrometry Techniques:

    • Hydrogen-Deuterium Exchange MS: Mapping protein interaction surfaces

    • Native MS of Membrane Complexes: Preserving lipid-protein interactions

    • Cross-linking MS with Novel Linkers: Identifying specific interaction interfaces

    • Top-Down Proteomics: Characterizing post-translational modifications

  • Artificial Intelligence and Computational Approaches:

    • AlphaFold2/RoseTTAFold: Accurately predicting membrane protein structures

    • Molecular Dynamics Simulations: Modeling protein-membrane interactions

    • Deep Learning for Function Prediction: Identifying novel functional motifs

    • Network Analysis: Understanding system-level interactions during viral assembly

  • Single-Molecule Techniques:

    • Single-Molecule FRET: Detecting conformational changes during assembly

    • Optical Tweezers: Measuring interaction forces between viral proteins

    • Single-Molecule Tracking: Visualizing M protein dynamics in living cells

    • Nanodiscs with Single-Molecule Spectroscopy: Controlled environment for biophysical studies

  • Organoid and Advanced Cell Culture Systems:

    • Bat Respiratory Organoids: Physiologically relevant infection models

    • Multi-Organ-on-a-Chip: Studying systemic aspects of infection

    • 3D Bioprinting: Creating complex tissue models for infection studies

    • Microfluidic Virus Evolution Platforms: Monitoring adaptive mutations under selection

  • CRISPR-Based Technologies:

    • Perturb-seq: Genome-wide screening for host factors interacting with M protein

    • Base Editing: Precise mutagenesis of M protein without double-strand breaks

    • CRISPRi/CRISPRa: Modulating expression of M protein interaction partners

    • CRISPR Screening in Bat Cells: Identifying species-specific factors

These technologies could be applied to better understand the structure-function relationships of the M protein, potentially revealing how variations in this protein contribute to host adaptation and virulence. For example, advanced structural methods could help determine how the M protein interacts with other viral proteins and host factors, similar to the detailed structural information already available for Spike protein-ACE2 interactions .

How might synthetic biology approaches advance bat coronavirus research?

Synthetic biology approaches offer transformative potential for bat coronavirus research through multiple innovative strategies:

  • Genome-Wide Reverse Genetics Systems:

    • Modular Cloning Systems: Rapid generation of chimeric viruses to test specific hypotheses

    • Landing Pad Technologies: Systematic replacement of viral genome segments

    • Viral Genome Writing: De novo synthesis of optimized or designed viral genomes

    • CAGES (Clustered Regularly Interspaced Short Palindromic Repeats-Associated Genome Engineering): Precise genome editing

  • Reporter Systems Integration:

    • Fluorescent and Luminescent Reporters: Real-time monitoring of viral replication

    • Split Reporter Complementation: Detecting protein-protein interactions in context

    • Conditional Reporters: Activation upon specific cellular events

    • Spectral Barcoding: Tracking multiple viral variants simultaneously

  • Orthogonal Expression Systems:

    • Synthetic Regulatory Circuits: Controlling virus replication with external stimuli

    • Genetic Safeguards: Built-in limitations to viral replication outside laboratory settings

    • Inducible Protein Degradation: Temporal control of viral protein function

    • Optogenetic Control: Light-regulated viral protein activity

  • Minimal and Expanded Genetic Systems:

    • Minimal Viral Genomes: Determining essential genetic elements

    • Expanded Genetic Code: Incorporation of non-canonical amino acids for biophysical studies

    • Synthetic Untranslated Regions: Optimizing viral gene expression

    • Codon Optimization/Deoptimization: Controlling virus replication efficiency

  • High-Throughput Functional Genomics:

    • Deep Mutational Scanning: Comprehensive analysis of protein tolerance to mutations

    • Saturation Mutagenesis: Identifying critical residues for protein function

    • Combinatorial Domain Swapping: Systematically testing chimeric proteins

    • Massively Parallel Reporter Assays: Characterizing regulatory element function

The potential of synthetic biology has been demonstrated in bat coronavirus research, where scientists designed and synthesized a consensus Bat-SCoV genome by aligning multiple sequences . This approach enabled the creation of infectious chimeric viruses, such as Bat-SRBD, which incorporated the RBD from human SARS-CoV into the bat coronavirus backbone .

Furthermore, synthetic biology approaches allowed researchers to test specific hypotheses about host adaptation. For example, the Y436H substitution was introduced into Bat-SRBD to create Bat-SRBD-MA, which demonstrated enhanced replication in mice, supporting predictions from structural modeling about receptor engagement . These examples illustrate how synthetic biology provides powerful tools for investigating the molecular determinants of coronavirus host range and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.