Recombinant Bat coronavirus 279/2005 Protein 3 (3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Shipping defaults to blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
3; Protein 3; Accessory protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Bat coronavirus 279/2005 (BtCoV) (BtCoV/279/2005)
Target Names
3
Target Protein Sequence
MDLFMSIFTLGAITRQPAKVENASPASTVHATATIPLQASLPFGWLVVGVALLAVFQSAS KVIALHKRWQLALYKGIQFVCNLLLLFVTIYSHLLLLAAGMEAQFLYIYALIYILQIVSF CRFIMRCWLCWKCRSKNPLLYDANYFVCWHTNCFDYCIPYNSITDTIVLTSGDGTTQPKL KEDYQIGGYSEDWHSGVKDYVVIHGYFTEIYYQLESTQLSTDTGAENATFFIYSKLVKDV DHVQIHTIDGSSGVVNPAMDPIYDEPTTTTSVPL
Uniprot No.

Target Background

Function
This protein forms homotetrameric potassium-sensitive ion channels (viroporins) and may modulate virus release. It upregulates the expression of fibrinogen subunits FGA, FGB, and FGG in host lung epithelial cells, induces apoptosis in cell culture, and downregulates the type 1 interferon receptor by inducing serine phosphorylation within the IFNα-receptor subunit 1 (IFNAR1) degradation motif and increasing IFNAR1 ubiquitination.
Subcellular Location
Virion. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein. Secreted. Host cytoplasm.

Q&A

How should Recombinant Bat coronavirus 279/2005 Protein 3(3) be stored and handled in laboratory settings?

For optimal preservation of Recombinant Bat coronavirus 279/2005 Protein 3(3), the protein should be stored in a Tris-based buffer containing 50% glycerol, which has been specifically optimized for this protein's stability . The recommended storage temperature is -20°C for regular use, while long-term storage should be at -20°C or -80°C to maintain protein integrity .

To prevent protein degradation through freeze-thaw cycles, researchers should avoid repeated freezing and thawing of the stock solution. Instead, it is advisable to create working aliquots that can be stored at 4°C for up to one week, minimizing the need to repeatedly access the main stock .

For experimental protocols requiring precise protein quantification, the standard commercial quantity is 50 μg, though other quantities may be available upon request . When designing experiments, researchers should consider the buffer composition when evaluating potential buffer interactions with experimental reagents or assay conditions.

What are the structural characteristics of Bat coronavirus accessory proteins?

While detailed structural information specifically for Bat coronavirus 279/2005 Protein 3(3) is limited in the provided search results, we can draw insights from structural studies of other coronavirus accessory proteins. Among the coronaviruses studied, only two SARS-CoV accessory proteins (p7a and p9b) have had their structures determined through X-ray crystallography .

Understanding the structural properties of coronavirus accessory proteins can be challenging due to their often unique sequences that lack obvious homology to proteins of known function. In the broader context of coronavirus biology, accessory proteins can serve diverse roles, with some being incorporated into virions as minor structural components. In fact, five of the SARS-CoV accessory proteins have been identified as minor structural proteins within viral particles .

Researchers investigating the structural characteristics of Protein 3(3) may need to employ computational modeling approaches, potentially leveraging tools like AlphaFold for structure prediction, though there are current limitations regarding access to such tools for novel protein analysis .

How does Bat coronavirus 279/2005 Protein 3(3) compare to accessory proteins in SARS-CoV and other coronaviruses?

Comparing Bat coronavirus accessory proteins with those of other coronaviruses reveals important patterns in viral evolution and function. While the SARS-CoV genome encodes eight accessory proteins, other coronaviruses including Bat coronavirus 279/2005 have their own complement of accessory proteins with varying degrees of homology .

Functional studies indicate that several accessory proteins across different coronaviruses share common mechanisms in virus-host interactions:

CoronavirusAccessory Protein FunctionExample Effects
SARS-CoVInterferon pathway modulationInhibition of type I interferon production
SARS-CoVPro-inflammatory cytokine regulationAltered inflammatory response
MHVVirulence factors (NS2, HE, ORF4, ORF5a)Attenuation when deleted in natural host
IBVGrowth advantage (3b protein)Increased virulence in chicken embryo when C-terminally truncated

When studying Bat coronavirus 279/2005 Protein 3(3), researchers should consider these comparative contexts to hypothesize about potential functions, particularly in virus-host interactions that may influence species-specific pathogenicity .

What experimental applications are suitable for Recombinant Bat coronavirus 279/2005 Protein 3(3)?

Recombinant Bat coronavirus 279/2005 Protein 3(3) can be utilized in a variety of experimental applications to investigate viral protein function and virus-host interactions. Based on the product description and our understanding of coronavirus accessory proteins, the following applications are particularly suitable:

  • ELISA-based studies: As indicated by the product description, this recombinant protein is designed for ELISA applications . This allows for:

    • Detection of antibodies against Bat coronavirus in serological studies

    • Evaluation of cross-reactivity with antibodies against other coronaviruses

    • Development of diagnostic tools for bat coronavirus detection

  • Immunological research: The protein can be used to:

    • Study host immune responses to specific viral components

    • Investigate antibody specificity and cross-reactivity between related coronavirus proteins

    • Develop and validate immunological assays for coronavirus detection

  • Protein-protein interaction studies: Researchers can employ techniques such as:

    • Pull-down assays to identify host cellular proteins that interact with Protein 3(3)

    • Yeast two-hybrid screening to map interaction networks

    • Co-immunoprecipitation to validate specific interactions in more native conditions

  • Functional characterization: To understand the protein's role in:

    • Modulation of interferon signaling pathways

    • Regulation of pro-inflammatory cytokine production

    • Potential effects on host cell processes like apoptosis or cell cycle regulation

These applications can provide valuable insights into the biological functions of Bat coronavirus 279/2005 Protein 3(3) and its potential role in viral pathogenesis and host adaptation.

How might Protein 3(3) contribute to virus-host interactions in coronavirus infections?

Based on studies of coronavirus accessory proteins, Bat coronavirus 279/2005 Protein 3(3) likely plays significant roles in virus-host interactions that influence infection outcomes. While not essential for basic replication in cell culture, these accessory proteins often contribute to pathogenesis in natural host environments .

Several mechanisms have been described for how coronavirus accessory proteins mediate virus-host interactions:

  • Immune response modulation: Many coronavirus accessory proteins interfere with interferon signaling pathways, which represent a critical first line of antiviral defense. Protein 3(3) may potentially suppress interferon production or interfere with downstream signaling to evade host immune responses .

  • Inflammatory response regulation: Coronavirus accessory proteins can modulate the production of pro-inflammatory cytokines, potentially contributing to either immune evasion or pathological inflammation depending on the context .

  • Structural roles: Some accessory proteins become incorporated into virions as minor structural components, potentially influencing viral stability, tropism, or entry mechanisms .

  • Host cell process manipulation: Accessory proteins may interact with host cellular machinery to create favorable conditions for viral replication, such as by altering cell cycle progression, metabolism, or vesicular trafficking.

Research from mouse hepatitis virus (MHV) demonstrates that deletion of certain accessory proteins leads to significant attenuation in natural hosts, highlighting their importance in in vivo infections despite being dispensable in cell culture . Similarly, mutations in accessory proteins of infectious bronchitis virus (IBV) can alter virulence in chicken embryos .

What methodologies can be used to study the functional roles of Bat coronavirus 279/2005 Protein 3(3) in viral pathogenesis?

Investigating the functional roles of Bat coronavirus 279/2005 Protein 3(3) requires a multi-faceted approach combining molecular, cellular, and in vivo techniques:

  • Reverse genetics systems: Researchers can generate recombinant viruses with modifications to the Protein 3(3) gene using approaches similar to those described for synthetic recombinant bat SARS-like coronavirus . This allows for:

    • Deletion mutants to assess the protein's contribution to viral replication and pathogenesis

    • Point mutations to identify critical functional residues

    • Domain swapping with homologous proteins from other coronaviruses to determine functional conservation

  • Transcriptomic and proteomic analyses: To identify host cell responses to Protein 3(3):

    • RNA-seq to characterize global transcriptional changes in cells expressing Protein 3(3)

    • Proteomics to identify altered protein expression or post-translational modifications

    • Phosphoproteomics to identify signaling pathways affected by the protein

  • Immunological assays: To assess impacts on host immune responses:

    • Cytokine profiling in cells expressing Protein 3(3)

    • Reporter assays for key immune signaling pathways (e.g., interferon response elements)

    • Flow cytometry to evaluate effects on immune cell activation and function

  • In vivo models: Although challenging with bat coronaviruses, researchers might consider:

    • Mouse-adapted systems similar to the approach used with Bat-SRBD-MA, which incorporated a Y436H substitution to enhance interaction with mouse ACE2

    • Humanized mouse models expressing relevant bat receptors

    • Ex vivo culture of bat tissues where available and ethically sourced

These methodologies can be combined to build a comprehensive picture of Protein 3(3)'s role in coronavirus biology and pathogenesis.

How can synthetic recombinant techniques be applied to study Bat coronavirus 279/2005 Protein 3(3) and related proteins?

Synthetic recombinant techniques represent a powerful approach for studying Bat coronavirus proteins, particularly when working with viruses that have not been successfully cultured. These methods can overcome significant challenges in coronavirus research:

  • Consensus sequence design: As demonstrated with Bat-SCoV, researchers can establish consensus sequences from multiple field isolates to design synthetic genes that represent the most likely functional form of the protein . For Protein 3(3), this approach can help address potential sequencing errors in database entries and create a representative construct for functional studies.

  • Chimeric protein construction: The receptor-binding domain (RBD) exchange strategy used to create Bat-SRBD demonstrates how domain swapping can be employed to investigate protein function . Similar approaches could be applied to:

    • Create chimeric versions of Protein 3(3) incorporating domains from homologous proteins in other coronaviruses

    • Test hypotheses about specific functional domains within the protein

    • Investigate evolutionary relationships between coronavirus accessory proteins

  • Full virus reconstruction: For comprehensive studies, researchers can employ approaches similar to those used to generate the 29.7-kb synthetic bat SARS-like coronavirus :

    • Design overlapping cDNA fragments with precise junctions

    • Assemble full-length genomes with modifications to Protein 3(3)

    • Test the effects of these modifications on viral replication and pathogenesis

  • Structure-guided design: Although limited structural information is available for many coronavirus accessory proteins, computational modeling combined with structure prediction tools could guide rational design of Protein 3(3) variants to test structure-function hypotheses .

These synthetic approaches allow researchers to investigate proteins from viruses that have not been isolated in culture, providing insights into potential mechanisms of zoonotic emergence and pathogenesis.

What are the implications of Bat coronavirus research for understanding zoonotic transmission potential?

Research on Bat coronavirus proteins, including Protein 3(3), provides critical insights into the mechanisms underlying zoonotic transmission of coronaviruses from bats to humans. The synthetic recombinant bat SARS-like coronavirus studies demonstrate how rational design and reverse genetics can be used to investigate potential pathways of cross-species transmission .

The replacement of the Bat-SCoV spike receptor-binding domain (RBD) with the SARS-CoV RBD in the Bat-SRBD construct simulated a theoretical recombination event that might occur during mixed infection in vivo . This approach successfully generated a chimeric virus that was infectious in cell culture and mice, and could be neutralized by antibodies against both bat and human coronavirus spike proteins . This experimental model supports the hypothesis that recombination events involving the spike protein can facilitate cross-species transmission.

For researchers studying Protein 3(3) and other accessory proteins, these findings suggest several important considerations:

  • Accessory proteins may undergo similar recombination events or adaptations that contribute to cross-species transmission potential.

  • While not essential for replication in vitro, accessory proteins can significantly influence pathogenesis in vivo, as demonstrated by studies in mouse hepatitis virus and infectious bronchitis virus .

  • The "mosaic" nature of coronavirus genomes, resulting from multiple recombination events, means that studying individual proteins like Protein 3(3) in isolation provides only partial insights into zoonotic potential .

  • Combined approaches that integrate structural biology, molecular virology, immunology, and animal models are necessary to fully understand the complex factors governing successful zoonotic transmission.

By applying synthetic biology and reverse genetics approaches to study Bat coronavirus 279/2005 Protein 3(3) and related proteins, researchers can contribute to a more comprehensive understanding of the molecular determinants of coronavirus host range and zoonotic potential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.