Recombinant Bat coronavirus 279/2005 Protein 7a (7a)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bat Coronavirus 279/2005 Protein 7a (7a)

Recombinant Bat coronavirus 279/2005 Protein 7a (7a) is an accessory protein derived from the bat coronavirus strain BtCoV/279/2005. This protein has garnered attention for its role in viral pathogenesis and its structural similarity to SARS-CoV accessory proteins. It is produced via recombinant expression in E. coli with a 10xHis-tag for purification and functional studies .

Apoptosis Induction

Protein 7a triggers caspase-dependent apoptosis by interacting with anti-apoptotic Bcl-2 family proteins (e.g., Bcl-X<sub>L</sub>, Mcl-1). This disrupts mitochondrial integrity, leading to cytochrome c release and PARP cleavage .

Cell Cycle Arrest

Overexpression of 7a inhibits retinoblastoma (Rb) phosphorylation, inducing G0/G1 arrest. The domain spanning aa 44–82 is critical for this function .

Immune Modulation

  • Pro-inflammatory Signaling: Activates NF-κB and JNK pathways, upregulating cytokines like IL-8 and RANTES .

  • Host Protein Interactions: Binds LFA-1 and SGT (small glutamine-rich tetratricopeptide repeat-containing protein), potentially disrupting host defense mechanisms .

Recombinant Production and Utility

ParameterDetailReference
Expression SystemE. coli (in vitro) with N-terminal 10xHis-tag
Expression Regionaa 16–122 (mature protein)
StabilityLyophilized form: 12 months at -20°C/-80°C; liquid: 6 months at -20°C

Comparative Insights with SARS-CoV 7a

AspectBat 7aSARS-CoV 7a
Essential RoleNon-essential for replication; contributes to pathogenesisNon-essential
Structural Homologyβ-sandwich fold; transmembrane domainβ-sandwich fold
Host InteractionBinds LFA-1; inhibits anti-apoptotic Bcl-2 proteinsBinds LFA-1

Note: SARS-CoV 7a studies inform functional hypotheses for Bat 7a .

Applications in Research and Public Health

  1. Zoonotic Transmission Studies: Used to model bat-to-human spillover events, particularly in understanding viral adaptation .

  2. Therapeutic Targeting: Serves as a model to develop pan-coronavirus inhibitors targeting conserved 7a domains .

  3. Diagnostic Tools: His-tagged recombinant protein facilitates antibody development for serological assays .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
7a; Protein 7a; Accessory protein 7a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
16-122
Protein Length
Full Length of Mature Protein
Species
Bat coronavirus 279/2005 (BtCoV) (BtCoV/279/2005)
Target Names
7a
Target Protein Sequence
ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCISTHFAFACADGTRHTY QLRARSVSPKLFTRQEEVHQELYSPLFLIVAALVFIILCFTIKRKTE
Uniprot No.

Target Background

Function
This protein is non-structural and dispensable for virus replication in cell culture.
Subcellular Location
Virion. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein.

Q&A

How do researchers differentiate between various bat coronavirus strains and their protein components?

Researchers differentiate bat coronavirus strains through several complementary methodological approaches:

  • Genome sequencing and phylogenetic analysis: Full-length genomic sequencing allows researchers to classify bat coronaviruses into lineages and compare them with known human coronaviruses. For example, researchers have identified 89 strains of lineage C betacoronaviruses from bat samples in South China, including MERS-related coronaviruses .

  • Protein domain analysis: Particular focus is placed on key proteins like Spike (S) protein and its receptor-binding domain (RBD), which determines host specificity. Researchers analyze the amino acid sequences and structures of these domains to predict potential host range .

  • Receptor usage studies: Experimental verification of which cellular receptors a virus can utilize helps distinguish between strains. For instance, MERS-related bat coronaviruses that use dipeptidyl peptidase 4 (DPP4) as a receptor have been identified .

  • Recombination analysis: Computational methods are employed to detect potential recombination events between different coronavirus strains, which may result in novel viruses with altered properties. Recent studies have provided evidence of natural recombination events between bat MERS-related coronaviruses and other bat coronaviruses like HKU4 .

What methodologies are used to design and synthesize recombinant bat coronaviruses for research purposes?

The synthesis of recombinant bat coronaviruses involves sophisticated methodologies that enable study of these viruses without requiring isolation from natural reservoirs:

  • Consensus sequence design: Researchers analyze multiple bat coronavirus sequences to establish a consensus genome sequence. For example, in 2008, scientists used four Bat-SCoV sequences (HKU3-1, HKU3-2, HKU3-3, and RP3) to create a consensus Bat-SCoV sequence .

  • cDNA fragment synthesis and assembly: The large coronavirus genome (approximately 30 kb) is divided into manageable fragments that are commercially synthesized and then assembled into a full-length cDNA. Specialized vector systems are used to maintain stability of these large constructs .

  • Transcriptional regulatory element incorporation: Functional elements such as the 5' UTR and transcriptional regulatory sequences from well-characterized viruses (like SARS-CoV) are often used to ensure proper expression of the synthetic genome .

  • In vitro transcription: The assembled cDNA is transcribed in vitro to generate genomic RNA for transfection into cells .

  • Recovery in cell culture: The synthetic genomic RNA is electroporated into susceptible cells to recover infectious virus. This critical step may require optimization, as initial attempts with consensus Bat-SCoV failed despite detection of viral transcripts .

  • Domain swapping for functional studies: Strategic replacement of specific domains, such as swapping the Bat-SCoV Spike receptor-binding domain (RBD) with the SARS-CoV RBD, enables investigation of host specificity determinants .

How do researchers evaluate the receptor usage and host range of recombinant bat coronaviruses?

Evaluation of receptor usage and host range involves multiple experimental approaches:

  • Protein-protein interaction assays: These assays directly test binding between viral spike proteins and potential host receptors. For example, studies demonstrated that MERS-related bat coronavirus spike proteins can bind to the receptor DPP4 .

  • Cell culture infectivity studies: Researchers test viral replication in cells from different species expressing various receptor molecules. The Bat-SRBD chimeric virus (containing the SARS-CoV receptor-binding domain in a bat coronavirus backbone) was shown to be infectious in cell culture .

  • Human airway epithelial (HAE) culture models: These more complex models better represent the natural target tissues of respiratory viruses. Both SARS-CoV and Bat-SRBD were found to replicate efficiently in HAE cultures, providing a direct human airway model .

  • Animal infection models: In vivo studies assess viral replication and pathogenesis. For instance, Bat-SRBD was tested in mice, though it replicated poorly without adaptation .

  • Receptor mutation analysis: Introduction of specific mutations in the receptor-binding domain helps identify key residues for receptor engagement. The Y436H substitution in the RBD was predicted and confirmed to enhance interaction with mouse ACE2 (mACE2) .

  • Biolayer interferometry: This technique measures biomolecular interactions between viral proteins and receptors, as demonstrated in studies of BANAL-236 spike protein with human ACE2 .

What techniques do researchers use to analyze the structural and functional aspects of coronavirus proteins like Protein 7a?

Multiple sophisticated techniques are employed to analyze coronavirus protein structure and function:

  • X-ray crystallography: This technique reveals detailed three-dimensional structures of viral proteins, often in complex with their receptors. The crystal structure of SARS-CoV RBD complexed with its receptor, human ACE2 (hACE2), has provided crucial insights into the virus-receptor interface .

  • Homology modeling: When crystal structures are unavailable, researchers use homology modeling to predict protein structures. This approach helped identify that the receptor-binding motif (RBM) within the RBD is critical for ACE2 engagement .

  • Molecular dynamics (MD) simulations: These computational techniques model protein movements and interactions at the atomic level. MD simulations have been used to analyze the interface stability between coronavirus RBDs and host receptors .

  • Site-directed mutagenesis: By introducing specific mutations into viral proteins, researchers can identify critical residues for various functions. Studies have shown that substitutions like K493Q and H498Q in the RBD affect interaction with human ACE2 .

  • Rosetta modeling: This computational approach models short-range protein-protein interfaces to identify key residues essential for host specificity. Researchers have used Rosetta modeling to predict mutations that enhance coronavirus RBD interaction with receptors .

What biosafety considerations are essential when conducting research with recombinant bat coronaviruses?

Research with recombinant bat coronaviruses requires stringent biosafety measures:

  • Risk assessment: Comprehensive evaluation of potential risks must precede experimental design. This includes analyzing the likelihood of generating viruses with enhanced virulence or transmissibility.

  • Containment facilities: Work with potentially infectious coronaviruses typically requires at minimum Biosafety Level 3 (BSL-3) facilities, particularly when creating chimeric viruses that might have pandemic potential.

  • Validation of attenuation strategies: When possible, researchers should incorporate attenuation strategies into recombinant virus design to reduce risks. This may include deleting essential virulence factors or engineering conditional replication mechanisms.

  • Monitoring protocols: Continuous health monitoring of laboratory personnel and environmental testing helps ensure containment is maintained.

  • Transparent reporting: Detailed documentation of biosafety protocols in publications enables proper evaluation of risk management strategies.

Researchers must balance the scientific value of studies like synthetic recombinant bat coronavirus creation against potential biosafety risks, particularly given the global impact of recent coronavirus pandemics .

What are the methodological approaches for studying coronavirus-host immune interactions using recombinant viral proteins?

Understanding coronavirus-host immune interactions involves multiple experimental approaches:

  • Neutralization assays: Researchers use recombinant viruses or proteins to evaluate neutralizing antibody responses. For example, Bat-SRBD was efficiently neutralized by antibodies specific for both bat and human coronavirus Spike proteins .

  • Antiviral protein design: Structure-based design has been used to create small proteins that block coronavirus infection. The lead antiviral candidate LCB1 demonstrated activity rivaling that of the best-known SARS-CoV-2 neutralizing antibodies in lab-grown human cells .

  • Animal immunization studies: These evaluate protective immunity against recombinant coronaviruses and help in vaccine development.

  • Protein-protein interaction mapping: Systematic analysis of interactions between viral and host proteins reveals mechanisms of immune evasion and pathogenesis.

  • Epitope mapping: Identifying specific regions of viral proteins recognized by antibodies enables understanding of cross-protection between related coronaviruses and guides vaccine design.

How can recombinant bat coronavirus proteins be utilized to develop antiviral strategies against emerging coronaviruses?

Recombinant bat coronavirus proteins serve as valuable tools for antiviral development:

  • Broad-spectrum antiviral screening: Using recombinant proteins from diverse bat coronaviruses enables identification of antivirals effective against multiple coronavirus species, potentially including those that might emerge in the future.

  • Structure-based drug design: Detailed structural information on coronavirus proteins facilitates the design of small-molecule inhibitors targeting conserved functional domains.

  • Receptor decoy development: Understanding receptor-binding mechanisms allows creation of soluble receptor decoys that can neutralize viruses before they infect cells.

  • Engineered antiviral proteins: Using protein design approaches, researchers have developed small proteins that protect cells from SARS-CoV-2 by blocking the virus-receptor interaction .

  • Cross-protective vaccine strategies: Immunization with recombinant proteins containing conserved epitopes may provide protection against multiple coronaviruses, including novel emergent strains.

These approaches are particularly important given that bat-borne SARS-CoV-2-like viruses potentially infectious for humans have been found circulating in Rhinolophus bat species .

What are the technical challenges in expressing and purifying functional recombinant coronavirus proteins for structural studies?

Researchers face several technical challenges when working with recombinant coronavirus proteins:

  • Size and complexity: Coronavirus structural proteins, particularly the Spike protein (~180 kDa), are large and contain multiple domains, making expression and purification challenging.

  • Post-translational modifications: Many coronavirus proteins require proper glycosylation for folding and function, necessitating mammalian or insect cell expression systems rather than bacterial systems.

  • Protein stability: Maintaining the native conformation of viral proteins during purification often requires optimization of buffer conditions and handling procedures.

  • Oligomerization: Some coronavirus proteins form functional oligomers (e.g., Spike forms trimers), and maintaining these quaternary structures during purification is essential for functional studies.

  • Domain boundaries: Determining optimal domain boundaries for structural studies requires careful bioinformatic analysis and experimental validation, particularly for multi-domain proteins.

  • Expression toxicity: Some viral proteins may be toxic to expression hosts, requiring inducible systems or specialized strains for production.

How can computational approaches enhance our understanding of recombinant bat coronavirus evolution and potential for human infection?

Computational methods are increasingly vital for coronavirus research:

  • Phylogenetic analysis: Advanced evolutionary models help track the emergence and diversification of bat coronaviruses and predict potential evolutionary pathways to human infection.

  • Recombination detection algorithms: These tools identify potential recombination events between different coronavirus strains, which may result in novel viruses with altered host ranges. Studies have demonstrated that MERS-related coronaviruses acquired their spike genes from a DPP4-recognizing bat coronavirus HKU4 through recombination .

  • Molecular dynamics simulations: These provide insights into protein flexibility and interaction dynamics that may not be captured by static structural studies.

  • Machine learning approaches: By analyzing patterns in coronavirus genome sequences, these methods can potentially predict which bat coronaviruses pose the greatest risk for human emergence.

  • Structural modeling: Computational prediction of protein structures and interactions enables rapid assessment of novel coronavirus strains without requiring laboratory work with infectious agents.

These computational approaches complement laboratory studies and may accelerate our understanding of bat coronavirus biology and zoonotic potential.

What methodological improvements are needed to better predict and prevent future coronavirus pandemics?

Several methodological improvements would enhance pandemic prevention efforts:

  • Expanded surveillance: More comprehensive sampling of bat populations globally would provide a better understanding of coronavirus diversity and geographic distribution.

  • Standardized risk assessment frameworks: Development of quantitative methods to assess the pandemic potential of newly discovered viruses would enable more effective prioritization of research efforts.

  • Improved cell culture models: Development of bat cell lines and organoids would enable more authentic studies of bat coronaviruses in their natural host environment.

  • Rapid functional characterization platforms: High-throughput methods to assess receptor usage, cell tropism, and immune evasion would accelerate the evaluation of novel viruses.

  • Integrated data platforms: Systems combining genomic, structural, functional, and ecological data would enable more holistic analysis of pandemic risk factors.

  • Collaborative research networks: Enhanced international collaboration and data sharing would accelerate scientific progress and pandemic preparedness.

The discovery that bat-borne SARS-CoV-2-like viruses potentially infectious for humans circulate in Rhinolophus bat species underscores the urgency of these methodological improvements .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.