Recombinant Bat coronavirus 512/2005 Membrane protein (M)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bat Coronavirus 512/2005 Membrane Protein (M)

The Recombinant Bat coronavirus 512/2005 Membrane protein (M) is the most abundant structural protein found in coronaviruses . It plays a crucial role in virus assembly through interactions with other viral proteins . The M protein is a component of the viral envelope and is essential for virus morphogenesis .

Role and Significance of M Protein in Coronaviruses

The membrane (M) protein is vital for the assembly of coronaviruses, including MERS-CoV, SARS-CoV, and SARS-CoV-2 . Its primary function involves interacting with other proteins, which is critical for virus assembly .

Interaction with Nucleocapsid (N) Protein

The M protein interacts with the nucleocapsid (N) protein, which facilitates virion assembly and budding of virus-like particles . The carboxy-terminus of the N protein mediates its interaction with batCOV5-M .

Identification of a Novel Bat Coronavirus

Researchers identified a novel coronavirus, Ro-BatCoV GCCDC1, from Rousettus leschenaulti, which belongs to group D of the genus betacoronavirus . This virus is related to Ro-BatCoV HKU9 and contains a p10 protein located at the 3’-end of the genome, likely captured from a bat-origin orthoreovirus through heterologous recombination .

Recombination Events in Coronaviruses

Homologous recombination events frequently occur during viral RNA replication in coronaviruses, contributing to their evolution . Coronaviruses might be one of the few virus families capable of undergoing heterologous recombination .

Scotophilus Bat Coronavirus-512

Scotophilus bat CoV-512, another bat coronavirus, has been detected in various bat species in Taiwan . Antibodies specific to the nucleocapsid (N) protein fragments of Scotophilus bat CoV-512 have been found in serum collected from Scotophilus kuhlii, Miniopterus fuliginosus, and Rhinolophus monoceros .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Bat coronavirus 512/2005 (BtCoV) (BtCoV/512/2005)
Target Names
M
Target Protein Sequence
MSSNQSVPVEEVIKHLRNWNFSWNIILTILLVVLQYGHYKYSRVLYGLKMAILWLLWPLV LALSIFDAWASFNVNWVFFAFSILMACVTAVLWIMYFVNSIRLWRRTHSWWSYNPETDSI LSVSVLGRHVCLPILGAPTGVTLTLLNGTLLVEGYQVATGVQVNNLPGYVTVAKASTTIV YQRVGRSMNANSSTGWAFFVKSKHGDYYAAANPTEVVTDSEKILHLV
Uniprot No.

Target Background

Function
A component of the viral envelope, this protein plays a crucial role in viral morphogenesis and assembly through its interactions with other viral proteins.
Database Links

KEGG: vg:11266521

Protein Families
Alphacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Scotophilus bat CoV-512 and why is its membrane protein significant?

Scotophilus bat CoV-512 is a group 1 coronavirus identified in multiple bat species, demonstrating potential for cross-species transmission. Molecular and serological evidence has confirmed that this virus can infect multiple animal species, making it an important model for studying coronavirus host adaptation . The membrane (M) protein, as one of the major structural proteins, plays essential roles in viral assembly, envelope formation, and host-pathogen interactions. Research on this protein is critical because:

The M protein constitutes the most abundant component of the coronavirus envelope and defines the shape of the viral envelope. Unlike the highly variable spike protein, the M protein is relatively conserved among coronavirus groups, making it an excellent target for developing broad-spectrum antivirals and vaccines. The M protein of Scotophilus bat CoV-512 is particularly interesting because it belongs to the Pedacovirus subgenus, which includes significant animal pathogens like porcine epidemic diarrhea virus (PEDV), with which it shares evolutionary relationships .

How does the M protein structure of Bat coronavirus 512/2005 compare to other coronaviruses?

The M protein of coronaviruses, including Bat coronavirus 512/2005, typically consists of three domains: a short amino-terminal ectodomain, a triple-spanning transmembrane domain, and a carboxy-terminal endodomain. While specific structural data for the Scotophilus bat CoV-512 M protein is limited in the provided research, comparative analyses suggest:

The M protein of Scotophilus bat CoV-512 maintains the typical coronavirus M protein architecture while exhibiting specific adaptations that may contribute to its broad host tropism. Recombination analysis has shown that Pedacovirus, the subgenus containing ScBt512, exhibits recombination hotspots at the junction of the S protein and ORF1ab, as well as in the N protein region . This suggests that while maintaining core structural features, the M protein may have undergone selective pressures contributing to the virus's adaptability across different host species.

How does the M protein contribute to cross-species transmission of Bat coronavirus 512/2005?

The M protein plays a crucial role in viral assembly and morphogenesis, which directly impacts the ability of the virus to successfully replicate in different host cells. Based on the research findings:

Scotophilus bat CoV-512 demonstrates a broad host range for cross-species transmission similar to SARS-CoV . While the spike protein is primarily responsible for receptor binding and initial entry, the M protein contributes to cross-species transmission through:

  • Interaction with host cell machinery during viral assembly

  • Modulation of host immune responses

  • Stabilization of the viral envelope structure in different cellular environments

Experiments using pseudoviruses have shown that Scotophilus bat CoV-512 had significantly higher entry efficiencies in Madin Darby dog kidney epithelial cells (MDCK), black flying fox brain cells (Pabr), and rat small intestine epithelial cells (IEC-6) . This broad tropism suggests that the M protein, working in concert with other viral proteins, has evolved features that enable efficient viral production across diverse cellular environments.

What recombination events involving the M protein have been observed in Bat coronavirus 512/2005?

Recombination analysis has revealed significant patterns involving coronaviruses in the Pedacovirus subgenus, which includes Scotophilus bat CoV-512:

A comprehensive recombination analysis identified 60 recombinant sequences involving PEDV, BT020, BatPeda_NL9, and ScBt512, primarily concentrated within BT020 and ScBt512 . The majority of recombination events occurred within species, particularly within ScBt512 . Phylogenetic analyses conducted on structural proteins, including the region encoding the M protein, revealed significant variations in clustering tendencies between sequences from ScBt512-A and ScBt512-B .

While Pedacovirus exhibited recombination hotspots at the junction of the S protein and ORF1ab, as well as in the N protein region , these recombination events might indirectly affect M protein function through altered interactions with other viral proteins. The prevalence of intraspecies recombination within ScBt512 suggests that genetic exchange plays a significant role in the evolution of this virus, potentially contributing to its adaptability.

What cell lines are optimal for studying Bat coronavirus 512/2005 M protein?

Based on the cell tropism studies of Scotophilus bat CoV-512, several cell lines show particular promise for M protein research:

Cell LineOriginEntry EfficiencySuitability for M Protein Studies
VeroAfrican green monkey kidneyHigh (544 red fluorescent cells)Excellent for viral assembly studies
MFKMyotis fimbriatus kidneyHigh (463 red fluorescent cells)Good for bat host interaction studies
HEK-293THuman embryonic kidneyHigh (384 red fluorescent cells)Ideal for recombinant protein expression
IEC-6Rat small intestineHigh (320 red fluorescent cells)Useful for cross-species adaptation studies
MDCKMadin Darby dog kidneyModerate (45 red fluorescent cells)Shows unique tropism for this virus
PabrBlack flying fox brainModerate (49 red fluorescent cells)Important for bat host range studies

Cell entry assays have demonstrated that Scotophilus bat CoV-512 pseudovirus can successfully infect all 11 tested cell lines, though with varying efficiencies . For optimal M protein studies, Vero, MFK, and HEK-293T cells offer high viral entry efficiency, suggesting they would provide robust systems for studying M protein function. HEK-293T cells were successfully used for pseudovirus production in previous studies , indicating their particular utility for recombinant protein expression.

How can researchers develop pseudovirus systems incorporating the M protein for functional studies?

The development of pseudovirus systems for studying the M protein function of Bat coronavirus 512/2005 can follow established protocols with specific modifications:

Based on the lentivirus-based pseudovirus system described for the S protein , a similar approach can be adapted for M protein studies:

  • Vector Construction:

    • Design expression vectors containing the M gene from Scotophilus bat CoV-512

    • Consider creating fluorescent protein fusions (e.g., M-eGFP) for visualization

    • Include appropriate promoters and selection markers

  • Pseudovirus Production:

    • Co-transfect HEK-293T cells with:
      a) A packing plasmid (e.g., pCMVdeltaR8.91)
      b) A transfer plasmid encoding reporter proteins (e.g., pLAS2w.RFP-C.Pneo)
      c) A plasmid encoding the M protein (e.g., pEGFP-Sco-M)

    • Harvest supernatant containing pseudoviruses after 72 hours

  • Functional Assays:

    • Infect target cells with the pseudoviruses

    • Evaluate infection efficiency through reporter gene expression

    • Assess the role of M protein through mutagenesis or inhibition studies

This approach provides a safe and effective system for studying M protein functions without requiring BSL-3 facilities needed for live coronaviruses.

What structural features of the M protein influence viral assembly and pathogenicity?

The M protein plays a central role in coronavirus assembly through specific structural domains that mediate critical interactions:

While specific structural data for Scotophilus bat CoV-512 M protein is not detailed in the provided research, coronavirus M proteins generally share common structural features that influence assembly:

  • N-terminal Ectodomain: This domain, though small, influences virion morphology and may interact with host immune components.

  • Transmembrane Domains: The three transmembrane helices anchor the protein in the viral envelope and contribute to membrane curvature during budding.

  • C-terminal Endodomain: This domain interacts with the nucleocapsid (N) protein and genomic RNA during assembly.

The M protein's structure also influences pathogenicity through:

  • Modulation of type I interferon responses

  • Interaction with host cell organelles

  • Regulation of inflammatory responses

Research on SARS-CoV has shown that specific residues in the M protein can significantly alter viral replication efficiency, which may also apply to Scotophilus bat CoV-512 given their phylogenetic relationship.

How do M protein interactions with other viral proteins contribute to coronavirus lifecycle?

The M protein forms a functional network with other structural proteins to facilitate coronavirus assembly and maturation:

M-S Protein Interactions:
The interaction between M and S proteins is critical for incorporating spike proteins into virions. Given that Scotophilus bat CoV-512 shows broad host tropism , these interactions must be sufficiently flexible to accommodate spike proteins that can engage diverse cellular receptors.

M-N Protein Interactions:
The M protein interacts with the N protein-RNA complex to facilitate packaging of the viral genome. Recombination analysis has shown hotspots in the N protein region of Pedacovirus , suggesting possible co-evolution of M-N interactions.

M-E Protein Interactions:
The M protein works with the small envelope (E) protein to form the viral envelope. These interactions determine virion morphology and stability in different environments.

These protein-protein interactions represent potential targets for antiviral strategies and may explain the adaptive capacity of Scotophilus bat CoV-512 across different host species.

How has the M protein of Bat coronavirus 512/2005 evolved in relation to other coronaviruses?

Evolutionary analysis suggests that the M protein of Scotophilus bat CoV-512 has followed a complex evolutionary path:

Phylogenetic analyses have placed Scotophilus bat CoV-512 within the Pedacovirus subgenus, showing evolutionary relationships with PEDV . Recombination has played a significant role in shaping the evolution of this virus, with 60 recombinant sequences identified involving ScBt512 . The close relationship and possible gene recombinants between Scotophilus bat CoV-512 and PEDV were observed through sequence alignments .

Specifically, the evolutionary patterns suggest:

  • The M protein likely maintains core functions across coronavirus lineages

  • Specific adaptations may have occurred in response to host-specific selective pressures

  • Recombination events have contributed to genetic diversity within the Pedacovirus subgenus

These evolutionary relationships have significant implications for understanding the potential for emergence of novel coronaviruses with altered host ranges.

What bioinformatic approaches are recommended for analyzing M protein conservation and variation?

Several bioinformatic approaches are particularly valuable for analyzing coronavirus M protein evolution:

  • Multiple Sequence Alignment (MSA):

    • Tools: MUSCLE, MAFFT, or Clustal Omega

    • Purpose: Identify conserved domains and variable regions across coronavirus M proteins

  • Phylogenetic Analysis:

    • Tools: RAxML, MrBayes, or IQ-TREE

    • Purpose: Reconstruct evolutionary relationships between M proteins from different coronaviruses

  • Recombination Detection:

    • Tools: RDP5 (as used in the cited research )

    • Purpose: Identify potential breakpoints and recombination events

  • Selection Pressure Analysis:

    • Tools: PAML, HYPHY, or Datamonkey

    • Purpose: Determine sites under positive or negative selection

  • Structural Prediction:

    • Tools: AlphaFold, I-TASSER, or SWISS-MODEL

    • Purpose: Predict structural implications of sequence variations

These approaches can help researchers understand how the M protein of Scotophilus bat CoV-512 has evolved to facilitate its remarkable cross-species transmission potential.

What are the challenges in expressing and purifying recombinant M protein?

Expressing and purifying membrane proteins like the coronavirus M protein presents several technical challenges:

  • Hydrophobicity and Solubility Issues:

    • The M protein contains multiple transmembrane domains that can cause aggregation

    • Solution: Use specialized detergents (DDM, LMNG) or amphipols for solubilization

  • Toxicity to Expression Hosts:

    • Overexpression of membrane proteins can disrupt host cell membranes

    • Solution: Use inducible expression systems with tight regulation

  • Proper Folding and Post-translational Modifications:

    • Mammalian-specific modifications may be essential for function

    • Solution: Use mammalian expression systems like HEK-293T cells, which have shown success in coronavirus protein expression

  • Yield Optimization:

    • Membrane proteins typically express at lower levels than soluble proteins

    • Solution: Optimize codon usage for the expression host and consider fusion tags that enhance expression

  • Functional Validation:

    • Ensuring the recombinant protein retains native structure and function

    • Solution: Develop functional assays based on known M protein activities

These challenges require careful optimization of expression conditions and purification protocols specific to the Scotophilus bat CoV-512 M protein.

How can researchers overcome difficulties in studying M protein-mediated viral assembly?

Studying M protein-mediated viral assembly presents unique challenges that can be addressed through specialized approaches:

  • Virus-Like Particle (VLP) Systems:

    • Co-express M with other structural proteins (E, N) to form VLPs

    • Analyze assembly efficiency through electron microscopy and biochemical assays

  • Live-Cell Imaging:

    • Create fluorescently tagged M proteins to visualize trafficking and assembly in real-time

    • Use super-resolution microscopy to observe nascent virion formation

  • In Vitro Reconstitution:

    • Purify individual components and reconstruct assembly processes in controlled conditions

    • Monitor assembly using light scattering, electron microscopy, or FRET-based assays

  • Cryo-Electron Microscopy:

    • Capture assembly intermediates through rapid freezing

    • Reconstruct 3D structures of assembly complexes

  • Split Reporter Assays:

    • Develop split luciferase or fluorescent protein complementation assays to monitor M-M and M-N interactions

    • Quantify assembly efficiency through reporter activity

These methodological approaches can provide insights into the specific role of the Scotophilus bat CoV-512 M protein in viral assembly across different host cellular environments.

What are the priorities for future research on Bat coronavirus 512/2005 M protein?

Several research priorities emerge from the current understanding of Scotophilus bat CoV-512 M protein:

  • Structural Biology:

    • Determine high-resolution structures of the M protein in different conformational states

    • Map interaction interfaces with other viral and host proteins

  • Host Range Determinants:

    • Identify M protein features that contribute to the virus's broad host range

    • Develop predictive models for host adaptation based on M protein sequences

  • Immune Evasion Mechanisms:

    • Characterize how the M protein interacts with host innate immune pathways

    • Develop strategies to overcome potential immune evasion

  • Antiviral Target Validation:

    • Evaluate the M protein as a target for broad-spectrum coronavirus antivirals

    • Screen for compounds that disrupt essential M protein functions

  • Recombination Dynamics:

    • Further investigate recombination events in the M protein region and their functional consequences

    • Develop surveillance approaches focused on detecting novel recombinants

These research priorities address both fundamental biological questions and applied aspects relevant to pandemic preparedness.

How might understanding the M protein contribute to broader coronavirus research?

Research on the Scotophilus bat CoV-512 M protein has significant implications for broader coronavirus research:

The cross-species transmission potential of Scotophilus bat CoV-512, comparable to that of SARS-CoV , makes it an important model for understanding zoonotic coronavirus emergence. The M protein, while less variable than the S protein, plays essential roles in viral lifecycle and host adaptation.

Key contributions include:

  • Evolutionary Insight: Understanding how core structural proteins like M evolve in conjunction with the more variable S protein can reveal constraints on coronavirus evolution.

  • Broad-Spectrum Countermeasures: The relatively conserved nature of M proteins makes them potential targets for broad-spectrum antivirals effective against multiple coronavirus species.

  • Predictive Models: Characterizing M protein variations across host species can contribute to predictive models for assessing zoonotic potential of novel coronaviruses.

  • Diagnostic Applications: Conserved epitopes in the M protein could serve as targets for broadly reactive diagnostic tests.

These broader applications highlight the importance of fundamental research on coronavirus structural proteins beyond the more commonly studied spike protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.