Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
3; Non-structural protein 3; ns3; Accessory protein 3a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Protein Length
full length protein
Species
Bat coronavirus 512/2005 (BtCoV) (BtCoV/512/2005)
Target Protein Sequence
MFLGLFQYTIDTAVEHTVEHANLSQEEALMLEENIVPLRQATHVTGFLLTSVFVYFFALF
KASSYKRNLLLFLARLLALLIYAPILIFCGAYLDAFIVVATLTSRLLFLTYYSWRYKTYK
FLIYNSSTLMFLHGHANYYNGRPYVMLEGGSHYVTLGTDIVPFVSRSNLYLAIRGSAESD
IQLLRTVELLDGNYLYIFSSCQVVGVTNSGFEEIQLDEYATISE