Recombinant Bat coronavirus HKU3 Membrane protein (M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Bat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3)
Target Names
M
Target Protein Sequence
MADNGTITVEELKQLLEQWNLVIGFIFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVT LACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNPETNILLN VPLRGTILTRPLMESELVIGAVIIRGHLRMAGHSLGRCDIKDLPKEITVATSRTLSYYKL GASQRVGTDSGFAAYNRYRIGNYKLNTDHSGSNDNIALLVQ
Uniprot No.

Target Background

Function
A key component of the viral envelope, this protein plays a crucial role in virus morphogenesis and assembly through interactions with other viral proteins.
Protein Families
Betacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the Membrane (M) protein of Bat coronavirus HKU3 and why is it significant for research?

The Membrane (M) protein is the most abundant structural protein found in coronaviruses, including bat coronaviruses such as HKU3. It plays a central role in viral assembly by mediating interactions with various partner proteins. Its significance lies in its high conservation across the coronavirus family, making it a potential target for broad-spectrum antiviral strategies and vaccine development. Unlike the more variable Spike (S) protein that undergoes frequent mutations, the M protein exhibits greater sequence stability, which is particularly valuable for understanding cross-species transmission potential and developing countermeasures with broader coverage against coronavirus variants .

What expression systems are commonly used for producing recombinant HKU3 M protein?

Recombinant HKU3 M protein can be produced using several expression systems, with mammalian cell-based expression being the most common for structural and functional studies. HEK293T cells are frequently employed for expressing the full-length M protein or M-GFP fusion proteins through transfection with plasmids such as pCMV3-C-GFPSpark encoding the desired protein construct . Lipofectamine 3000 or similar transfection reagents are typically used for efficient DNA delivery. For structural studies requiring larger protein quantities, bacterial expression systems using E. coli may be utilized for expressing the cytoplasmic domain, though these often require optimization due to the hydrophobic nature of the transmembrane regions. Insect cell-based systems using baculovirus vectors have also shown promise for expressing membrane proteins with proper folding and post-translational modifications .

What are the key functional domains of the Bat coronavirus HKU3 M protein?

The Bat coronavirus HKU3 M protein, like other coronavirus M proteins, consists of several key functional domains:

  • N-terminal ectodomain: A small domain exposed on the virion surface that can be recognized by antibodies and serves as a potential target for immune responses

  • Transmembrane domains: Multiple (typically three) hydrophobic regions that anchor the protein in the viral envelope

  • Cytoplasmic domain: The largest portion of the protein, facing the interior of the virion, which mediates critical interactions with other viral proteins including the nucleocapsid (N) protein

  • C-terminal domain (CTD): Contains positively charged residues that interact with the negatively charged C-terminal region of the N protein, facilitating viral assembly

These domains work collectively to enable the M protein's role in virus assembly, membrane curvature formation, and interactions with other structural proteins like E, S, and N proteins .

How can recombinant chimeric systems using HKU3 M protein help assess zoonotic potential?

Recombinant chimeric systems incorporating the HKU3 M protein provide valuable tools for assessing zoonotic potential through several approaches:

  • Receptor binding studies: By creating chimeras that combine the conserved M protein with variable Spike protein receptor binding domains (RBDs), researchers can assess the capacity of bat coronaviruses to engage human receptors such as ACE2. For example, chimeric Bat-SCoV genomes containing the SARS-CoV RBM (Bat-SRBM) or RBM plus distal "hinge" residues (Bat-Hinge) have been constructed to evaluate potential cross-species transmission .

  • Replication competence: Evaluating whether chimeric viruses can replicate in human airway epithelial (HAE) cultures provides critical insights into their potential to infect human cells. Studies have shown that chimeric viruses containing bat coronavirus backbones with humanized receptor binding domains can replicate efficiently in HAE cultures, despite showing poor replication in mouse models without additional adaptations .

  • Immune evasion assessment: Analyzing whether human monoclonal antibodies (hmAbs) targeting SARS-CoV can neutralize chimeric viruses containing HKU3 M protein provides information about potential protective measures against emerging coronaviruses. Research has demonstrated that antibodies specific for SARS-CoV RBD can neutralize chimeric bat coronaviruses, suggesting that current SARS-CoV vaccines might offer cross-protection .

These approaches collectively help researchers predict the zoonotic potential of bat coronaviruses and inform surveillance and prevention strategies.

What methodologies can be employed to study M protein-nucleocapsid (N) protein interactions in HKU3?

Several complementary methodologies can be employed to study M protein-nucleocapsid (N) protein interactions in HKU3 coronavirus:

  • Pull-down assays: These assays can determine direct protein-protein interactions between the M protein and specific regions of the N protein. Studies with related bat coronaviruses have shown that the C-terminal acidic region of the N protein (N₃C) interacts with the positively charged CTD of the M protein .

  • Microscale thermophoresis (MST): This technique measures binding affinities between purified M protein and N protein fragments. MST has been used to demonstrate that mutations in acidic residues of the N protein's C-terminal domain (e.g., E415, D416, D419, D424, and E426) can decrease binding affinity for the M protein to varying degrees .

  • Immunofluorescence co-localization: By expressing M-GFP fusion proteins in mammalian cells and using specific antibodies against the N protein, researchers can visualize the co-localization of these proteins intracellularly. This approach employs laser scanning confocal microscopy after appropriate cell fixation, permeabilization, and staining procedures .

  • Computational docking analysis: Molecular docking can predict interaction interfaces between M and N proteins based on their crystal structures. This computational approach complements experimental methods and helps generate testable hypotheses about specific amino acid residues involved in the interaction .

  • Mutagenesis studies: Site-directed mutagenesis of key residues in either the M or N protein, followed by interaction assays, can validate the importance of specific amino acids in mediating the M-N interaction .

The combination of these methodologies provides a comprehensive understanding of the molecular mechanisms underlying M-N protein interactions in coronavirus assembly.

What are the challenges and solutions in crystallizing the membrane-bound M protein for structural studies?

Crystallization of membrane-bound proteins like the coronavirus M protein presents significant challenges due to their hydrophobic nature and structural complexity. Key challenges and corresponding solutions include:

ChallengeSolution Approaches
Hydrophobic transmembrane domainsTruncation strategies to express soluble domains separately; use of detergents for full-length protein
Conformational heterogeneityStabilization through binding partners or antibody fragments; engineering of stabilizing mutations
Low expression yieldsOptimization of expression systems; use of fusion tags (e.g., MBP, SUMO) to enhance solubility
Crystal packing difficultiesLCP (Lipidic Cubic Phase) crystallization method; use of crystallization chaperones
Protein instabilityBuffer optimization with specific lipids and additives; rapid purification protocols

Researchers have successfully addressed these challenges by focusing on specific domains of the M protein, such as the cytoplasmic domain, which is more amenable to crystallization. The crystal structure of the M protein from Pipistrellus bat coronavirus HKU5 provides a valuable template for understanding the structural properties of related coronavirus M proteins, including HKU3 . This structure has revealed important insights into how the positively charged CTD interacts with other viral components, particularly the negatively charged C-terminal domain of the N protein .

How does antibody-dependent cellular cytotoxicity (ADCC) targeting the M protein differ from neutralizing antibody mechanisms against the Spike protein?

Antibody-dependent cellular cytotoxicity (ADCC) targeting the M protein represents a fundamentally different immune mechanism compared to neutralizing antibodies against the Spike protein:

  • Exposure and accessibility: While neutralizing antibodies target the exposed Spike protein to block receptor binding and prevent viral entry, ADCC-mediating antibodies against the M protein target the smaller ectodomain that has limited exposure on the virion surface . This makes M-specific ADCC potentially less efficient but more conserved across variants.

  • Mechanism of action: Neutralizing antibodies directly block the receptor-binding function of the Spike protein, whereas M-specific antibodies recruit effector cells (NK cells, macrophages) through Fc receptor engagement to eliminate infected cells expressing M protein on their surface .

  • Conservation advantage: Due to the higher conservation of the M protein compared to the Spike protein, M-directed ADCC may provide broader protection against coronavirus variants. Research has shown that M protein ectodomain-specific monoclonal antibodies like 3M1C11 can effectively elicit ADCC activity against cells expressing the M protein in vitro .

  • Timing of effectiveness: Neutralizing antibodies primarily prevent infection, while ADCC mechanisms are most effective after cells are already infected and expressing viral proteins, potentially limiting viral spread rather than preventing initial infection .

  • Combined approach: Studies have demonstrated synergistic effects when combining M protein-specific antibodies with RBD-specific antibodies, suggesting that targeting multiple viral proteins simultaneously may provide enhanced protection against SARS-CoV-2 and related viruses .

This distinction highlights the potential value of developing vaccines and therapeutics that elicit both neutralizing antibodies against Spike and ADCC-mediating antibodies against the more conserved M protein.

What are the optimal protocols for expression and purification of recombinant HKU3 M protein for structural studies?

The optimal protocol for expression and purification of recombinant HKU3 M protein for structural studies involves several critical steps:

  • Expression system selection:

    • For full-length M protein: Mammalian expression using HEK293T cells with strong promoters (CMV) and appropriate fusion tags (GFP, His-tag)

    • For soluble domains: Bacterial expression using E. coli BL21(DE3) with specialized vectors containing solubility-enhancing tags (SUMO, MBP)

  • Expression optimization:

    • Transfection conditions: Lipid-based transfection (Lipofectamine 3000) with 2 μg plasmid DNA per well for mammalian cells

    • Induction parameters: For bacterial systems, use 0.5 mM IPTG and lower temperature (16-18°C) for overnight expression to enhance proper folding

  • Cell lysis and membrane protein extraction:

    • Gentle lysis using detergent mixtures (1% DDM, 0.2% CHS, or 1% Triton X-100)

    • Mechanical disruption via sonication or homogenization in buffers containing protease inhibitors

  • Purification strategy:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

    • Intermediate purification: Size exclusion chromatography to separate monomeric from aggregated protein

    • Final polishing: Ion exchange chromatography if higher purity is required

  • Stabilization during purification:

    • Buffer optimization with 150-300 mM NaCl, 20 mM Tris-HCl pH 7.5, 5% glycerol

    • Addition of appropriate detergents at concentrations above their critical micelle concentration

  • Quality control:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Dynamic light scattering to assess homogeneity

    • Thermal shift assays to evaluate stability

This protocol has been successfully adapted from studies with related coronavirus M proteins, such as the batCOV5-M protein, which yielded crystals suitable for high-resolution structural determination .

How can peptide vaccines targeting conserved epitopes in the M protein ectodomain be designed and evaluated?

The design and evaluation of peptide vaccines targeting conserved epitopes in the M protein ectodomain involves a systematic approach:

  • Epitope identification and peptide design:

    • Analyze sequence conservation across coronavirus strains using multiple sequence alignment

    • Predict B-cell and T-cell epitopes using computational tools

    • Design peptides of appropriate length (typically 19-30 amino acids) covering conserved regions

    • Include structured elements that mimic native protein conformation

  • Peptide synthesis and conjugation:

    • Synthesize candidate peptides using solid-phase peptide synthesis

    • Conjugate to carrier proteins like keyhole limpet hemocyanin (KLH) to enhance immunogenicity

    • Confirm secondary structure using circular dichroism (CD) spectroscopy

  • Immunization protocols:

    • Use intraperitoneal immunization in BALB/c mice with adjuvants like incomplete Freund's adjuvant (IFA)

    • Follow prime-boost regimens with 2-3 week intervals between immunizations

    • Collect serum samples for antibody analysis

  • Immunological evaluation:

    • Measure peptide-specific IgG responses using ELISA

    • Assess cross-reactivity with variant peptides to confirm breadth of response

    • Evaluate T-cell responses using ELISpot assays measuring IFN-γ and IL-4 secretion

  • Functional assays:

    • Conduct microneutralization assays to assess inhibition of viral replication

    • Perform ADCC reporter assays using effector cells (Jurkat-Lucia NFAT-CD16) and target cells expressing M protein

    • Evaluate synergistic effects with other antibodies (e.g., RBD-specific)

  • In vivo protection studies:

    • Challenge vaccinated transgenic mice (e.g., K18-hACE2) with live virus

    • Monitor viral load, body weight, survival, and pathological changes

    • Assess protection against multiple virus variants

Research has demonstrated that peptide vaccines targeting the M protein ectodomain, such as S2M2-30-KLH, can induce robust humoral and cellular immune responses that contribute to protection against SARS-CoV-2 variants, suggesting similar approaches may be effective for bat coronaviruses like HKU3 .

What cell culture systems are most appropriate for studying HKU3 M protein trafficking and virus assembly?

Several cell culture systems are appropriate for studying HKU3 M protein trafficking and virus assembly, each offering distinct advantages:

  • HEK293T cells:

    • Highly transfectable, allowing efficient expression of recombinant M protein

    • Suitable for transient expression of M-GFP fusion proteins for localization studies

    • Used in co-transfection experiments to study M protein interactions with other viral components

    • Support imaging studies using confocal microscopy after immunostaining

  • Human airway epithelial (HAE) cultures:

    • Physiologically relevant primary cell system that mimics human airway

    • Supports replication of recombinant bat coronaviruses, allowing study of M protein in context of viral infection

    • Enables assessment of M protein localization during authentic viral assembly

    • Valuable for testing antivirals targeting M protein function

  • Vero E6 cells:

    • Permissive for coronavirus replication

    • Widely used for propagating recombinant coronaviruses

    • Suitable for immunofluorescence studies of M protein trafficking

  • Bat cell lines (e.g., Pteropus alecto kidney cells):

    • Species-matched context for studying bat coronavirus proteins

    • Allows investigation of host-specific factors affecting M protein function

    • Useful for comparative studies of M protein behavior in natural vs. potential new hosts

  • Specialized reporter systems:

    • Cells expressing fluorescent markers for specific cellular compartments

    • Enable real-time visualization of M protein trafficking through the secretory pathway

    • Used to study co-localization with other viral proteins during assembly

For functional studies, live cell imaging using spinning disk confocal microscopy of cells expressing fluorescently tagged M protein has proven effective for tracking protein movement and interactions. For structural analysis, fixed cells can be processed for immunofluorescence using protocols involving 4% paraformaldehyde fixation, 0.2% Triton X-100 permeabilization, and staining with specific antibodies followed by fluorescent secondary antibodies .

What are the most effective approaches for generating monoclonal antibodies against conformational epitopes of the M protein?

Generating monoclonal antibodies against conformational epitopes of the M protein requires specialized approaches to preserve native protein structure. The most effective methods include:

  • Immunization strategies:

    • Use of full-length recombinant M protein in nanodiscs or liposomes to maintain native conformation

    • Immunization with cells expressing M protein on their surface to present conformational epitopes

    • Prime-boost approaches with DNA vaccination followed by protein boosting

    • Peptide-KLH conjugates covering structured regions of the ectodomain

  • B cell isolation and screening:

    • Single B cell sorting using fluorescently labeled M protein as bait

    • Memory B cell immortalization through EBV transformation or hybridoma generation

    • High-throughput screening for conformational epitope recognition using native protein ELISA

  • Antibody characterization:

    • Epitope binning to identify antibodies targeting distinct conformational regions

    • Competition assays with known ligands or other antibodies

    • Cross-reactivity testing with M proteins from different coronavirus strains

    • Binding kinetics analysis using surface plasmon resonance or bio-layer interferometry

  • Functional assessment:

    • ADCC reporter assays using Jurkat-Lucia NFAT-CD16 effector cells and target cells expressing M protein

    • Complement-dependent cytotoxicity assays

    • Virus neutralization assays to identify antibodies that may interfere with virus assembly

    • In vivo protection studies in animal models

  • Structural characterization:

    • X-ray crystallography of antibody-epitope complexes

    • Cryo-EM analysis of antibody bound to full-length M protein

    • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

One successful example is the generation of the S2M2-30-specific monoclonal antibody 3M1C11, isolated from S2M2-30-KLH-immunized BALB/c mice using single B cell sorting-based amplification. This antibody showed strong binding activity to the S2M2-30 peptide and effectively elicited ADCC activity against cells expressing M protein .

How does the charge distribution in the C-terminal domain of HKU3 M protein influence its interaction with the nucleocapsid protein?

The charge distribution in the C-terminal domain (CTD) of HKU3 M protein plays a crucial role in mediating its interaction with the nucleocapsid (N) protein through electrostatic interactions. Based on structural and functional studies of related bat coronaviruses:

  • Positive charge cluster in M protein CTD:

    • The CTD of bat coronavirus M proteins contains a high concentration of positively charged residues (Lys/Arg/His)

    • This positive charge cluster creates an electrostatic potential that attracts negatively charged regions of partner proteins

    • The conservation of this feature across betacoronaviruses suggests a fundamental functional importance

  • Complementary negative charges in N protein:

    • The C-terminal region of the N protein (N₃) follows a conserved pattern with "basic-amino-half-and-acidic-carboxy-half"

    • Specifically, the carboxy-terminal half (N₃C, residues 411-427) contains multiple acidic residues (E415, D416, D419, D424, and E426)

    • Pull-down analysis has demonstrated that the N₃C region, but not the N₃N region, can effectively bind to the M protein

  • Mutational evidence:

    • Single mutations at acidic residue positions in the N₃C region decrease binding affinity for M protein to varying degrees

    • This confirms the importance of these negatively charged residues in the interaction with the positively charged M protein CTD

  • Functional significance:

    • The electrostatic interaction between M and N proteins is essential for viral assembly

    • This interaction helps organize the incorporation of the ribonucleoprotein complex into virions during budding

    • The strength of this interaction may influence the efficiency of virus assembly and production

This charge-based interaction mechanism appears to be conserved across betacoronaviruses, including MERS-CoV, SARS-CoV, and SARS-CoV-2, despite sequence variations in the specific proteins . The conservation of this pattern suggests it represents a fundamental aspect of coronavirus assembly that could potentially be targeted for broad-spectrum antiviral development.

What computational models best predict the membrane topology and protein-protein interaction interfaces of the HKU3 M protein?

Several computational approaches have proven effective for predicting the membrane topology and protein-protein interaction interfaces of coronavirus M proteins like HKU3 M:

  • Membrane topology prediction:

    • TMHMM and MEMSAT algorithms accurately predict the three transmembrane domains of M protein

    • PHDhtm combined with experimental validation provides reliable topology models showing N-terminal ectodomain, three transmembrane segments, and cytoplasmic C-terminal domain

    • AlphaFold2 has demonstrated significant predictive power for membrane protein structures with the highest ranking models showing good correlation with experimental data

  • Protein-protein interaction interface prediction:

    • Molecular docking platforms like HADDOCK and ClusPro effectively model M-N protein interactions

    • Electrostatic surface potential calculations using APBS (Adaptive Poisson-Boltzmann Solver) help identify complementary charged surfaces

    • Machine learning approaches like ISPRED and WHISCY that combine sequence conservation and structural information achieve higher accuracy in interface prediction

  • Molecular dynamics simulations:

    • All-atom MD simulations in explicit lipid bilayers provide insights into dynamic behaviors of M protein

    • Coarse-grained models using MARTINI force field allow longer timescale simulations of membrane-protein systems

    • Steered molecular dynamics can probe the strength of protein-protein interfaces under force

  • Integrative modeling:

    • Combining structural information from crystallography with computational models provides the most reliable predictions

    • Rosetta-modeling of short-range receptor interfaces has successfully identified key residues essential for protein interactions

    • Cross-linking mass spectrometry data integrated with computational models helps validate predicted interfaces

The most successful approach has been to use AlphaFold2 for initial structural prediction, followed by refinement through molecular dynamics simulations in membrane environments, and validation using experimental data from mutagenesis studies. This integrated approach has successfully predicted interaction interfaces between M and N proteins in coronaviruses, providing a framework for understanding these critical viral assembly interactions .

How can circular dichroism spectroscopy be used to analyze secondary structure elements in synthetic peptides derived from the M protein?

Circular dichroism (CD) spectroscopy is a powerful technique for analyzing secondary structure elements in synthetic peptides derived from the M protein, providing valuable insights into their conformational properties:

This technique was employed in the development of peptide vaccines targeting the M protein ectodomain, where CD spectroscopy confirmed that synthesized peptides adopted secondary structures similar to those in the native protein, contributing to their effectiveness as immunogens .

What roles do post-translational modifications of the M protein play in virus assembly and host immune responses?

Post-translational modifications (PTMs) of the coronavirus M protein play diverse and critical roles in virus assembly and host immune responses:

  • N-linked glycosylation:

    • Location: Primarily on the N-terminal ectodomain

    • Function in assembly: Influences M protein folding, stability, and interactions with other viral proteins

    • Impact on immune response: Creates epitopes recognized by antibodies and alters antigen processing

    • Variation: M proteins from different coronaviruses show distinct glycosylation patterns; some have multiple sites while others have minimal glycosylation

  • Palmitoylation:

    • Location: Typically on cysteine residues near the membrane-spanning regions

    • Function in assembly: Enhances membrane association and may facilitate incorporation into lipid rafts

    • Impact on trafficking: Influences protein sorting and localization within cellular compartments

    • Assembly role: May stabilize protein-protein interactions during virion formation

  • Phosphorylation:

    • Location: Primarily on serine/threonine residues in the cytoplasmic domain

    • Function in assembly: Regulates interactions with the N protein and genomic RNA

    • Regulatory role: May serve as a switch controlling the timing of assembly events

    • Host response: Can be mediated by host kinases as part of innate immune response

  • Ubiquitination:

    • Location: Lysine residues in the cytoplasmic domain

    • Function: May regulate M protein turnover and availability during infection

    • Immune evasion: Some coronaviruses may manipulate ubiquitination to evade host degradation pathways

  • Impact on immune recognition:

    • PTMs, particularly glycosylation, can mask epitopes from antibody recognition

    • Modified epitopes may generate distinct antibody responses compared to unmodified protein

    • Some PTMs create neo-epitopes that can be specifically targeted by the immune system

    • Glycosylation patterns can affect M protein presentation to T cells, influencing cellular immunity

The understanding of these modifications is critical for:

  • Designing effective vaccines that properly present M protein epitopes

  • Developing targeted antivirals that disrupt specific modification-dependent functions

  • Predicting cross-reactive immune responses across different coronavirus strains

  • Understanding species-specific differences in coronavirus assembly and pathogenesis

Research with SARS-CoV-2 has shown that antibodies targeting differently modified forms of the M protein can exhibit distinct functional properties, including varying abilities to mediate ADCC, highlighting the importance of considering PTMs in vaccine development strategies .

How might differences between bat and human cellular environments affect the function of recombinant HKU3 M protein in experimental systems?

The functional behavior of recombinant HKU3 M protein can be significantly influenced by differences between bat and human cellular environments in several key areas:

  • Membrane composition differences:

    • Bat cells may have distinct lipid compositions that affect M protein insertion and orientation

    • Cholesterol content variations could impact M protein clustering and distribution

    • Different sphingolipid profiles between species may alter protein-lipid interactions critical for function

  • Post-translational modification machinery:

    • Species-specific glycosylation patterns due to different glycosyltransferase repertoires

    • Variations in phosphorylation sites due to kinase substrate preferences

    • Potential differences in ubiquitination and other modifications affecting protein stability

  • Protein-protein interaction networks:

    • Bat-specific cellular binding partners may be absent in human cells

    • Human cellular proteins may interact with M protein differently than their bat counterparts

    • Adaptation may be required for efficient interaction with human-cell counterparts

  • Intracellular trafficking pathways:

    • Species-specific differences in the ERGIC and Golgi compartments where coronavirus assembly occurs

    • Variations in cytoskeletal organization affecting protein transport

    • Different vesicular transport regulators potentially altering M protein localization

  • Cellular stress responses:

    • Bat cells have evolved unique stress response mechanisms that may interact differently with viral proteins

    • Human cells may recognize bat viral proteins as more foreign, triggering stronger innate responses

    • Temperature differences (bats have higher body temperatures during flight) may affect protein folding

These differences can lead to several experimental considerations:

  • Expression systems using human cell lines may not fully recapitulate the natural behavior of bat coronavirus M proteins

  • Functional studies may require parallel experiments in both bat and human cellular backgrounds

  • Chimeric proteins combining domains from bat and human-adapted coronaviruses may provide insights into adaptation mechanisms

  • Temperature-controlled experiments might be necessary to account for physiological differences

Research with recombinant bat SARS-like coronaviruses has demonstrated that chimeric viruses can replicate efficiently in human airway epithelial cultures but may require adaptation for efficient replication in other systems, highlighting the importance of cellular context in studying these proteins .

What are the most promising strategies for designing broad-spectrum antivirals targeting conserved features of coronavirus M proteins?

Designing broad-spectrum antivirals targeting conserved features of coronavirus M proteins offers several promising strategies:

  • Disrupting M-N protein interactions:

    • Small molecules targeting the electrostatic interface between M protein's positively charged CTD and N protein's negatively charged C-terminus

    • Peptide mimetics based on the N₃C region that compete for M protein binding

    • Stapled peptides that maintain critical structural elements for binding inhibition

    • This approach leverages the highly conserved charge-based interaction mechanism across betacoronaviruses

  • Targeting M protein oligomerization:

    • Small molecules that interfere with M-M interactions essential for lattice formation

    • Compounds disrupting the transmembrane domain interactions critical for virus assembly

    • Peptides derived from M protein oligomerization interfaces acting as competitive inhibitors

  • Inhibiting M protein-mediated membrane curvature:

    • Compounds that alter membrane rigidity to counteract M protein's ability to induce curvature

    • Molecules binding to the cytoplasmic domain to prevent its membrane-deforming function

    • Lipid mimetics that compete for binding sites on the M protein

  • Antibody-based approaches:

    • Broadly neutralizing antibodies targeting conserved epitopes in the M protein ectodomain

    • Bispecific antibodies linking M protein recognition with Fc receptor engagement to promote ADCC

    • Antibody-drug conjugates delivering antivirals specifically to cells expressing M protein

  • Structure-based drug design:

    • Virtual screening campaigns targeting binding pockets identified in the M protein crystal structure

    • Fragment-based approaches to develop high-affinity ligands for conserved cavities

    • Allosteric inhibitors that lock the M protein in non-functional conformations

  • RNA-based therapeutics:

    • siRNA targeting conserved regions of M protein mRNA

    • Antisense oligonucleotides blocking M protein translation

    • CRISPR-Cas13 systems targeting viral RNA encoding M protein

The most promising approaches combine structural understanding with functional insights, such as targeting the electrostatic interactions between M and N proteins that are conserved across coronaviruses. Small molecules disrupting these interactions could potentially inhibit assembly of multiple coronavirus species, providing broad-spectrum activity against current and emerging threats .

How can knowledge of M protein structure-function relationships inform next-generation coronavirus vaccine design?

Knowledge of M protein structure-function relationships provides several strategic advantages for next-generation coronavirus vaccine design:

  • Targeting conserved epitopes for broad protection:

    • The highly conserved nature of M protein across coronavirus strains makes it an ideal target for broadly protective vaccines

    • Structural analysis has identified the ectodomain as containing cross-reactive epitopes that could provide protection against multiple coronavirus strains

    • Vaccines incorporating both variable (S protein) and conserved (M protein) antigens could offer broader protection against emerging variants

  • Rational epitope selection based on structural accessibility:

    • Crystal structures of M proteins help identify surface-exposed regions accessible to antibodies

    • Understanding which domains face the virion exterior versus interior informs selection of vaccine targets

    • Peptide vaccines can be designed to include the most exposed and immunogenic portions of the ectodomain

  • Structure-guided stabilization of conformational epitopes:

    • Knowledge of secondary structure elements allows engineering of more stable immunogens

    • Circular dichroism spectroscopy can confirm that synthetic peptides maintain native-like conformations

    • Stabilized constructs presenting key epitopes in their proper conformation elicit more relevant antibody responses

  • Targeting functional interfaces for greater efficacy:

    • Understanding M protein's role in virus assembly reveals critical interfaces that, when blocked, prevent viral replication

    • Vaccines eliciting antibodies that interfere with M-N protein interactions could block virus assembly

    • Structure-function insights identify regions where antibody binding would most effectively disrupt viral functions

  • Informed adjuvant and platform selection:

    • Structural characteristics of M protein epitopes inform optimal presentation methods

    • Knowledge of how M protein interacts with immune receptors guides adjuvant selection

    • Understanding processing requirements for M protein epitopes influences delivery platform design

  • Multi-mechanism protection strategies:

    • M protein-specific antibodies can mediate ADCC against infected cells

    • Combined with neutralizing antibodies against S protein, this creates a multi-layered defense

    • Studies have demonstrated synergistic protection when combining M-specific and RBD-specific antibody responses

Experimental evidence supports this approach, as peptide vaccines like S2M2-30-KLH targeting the M protein ectodomain have shown the ability to elicit protective immune responses in animal models. Moreover, combining M protein-targeted immunity with S protein-targeted responses demonstrated synergistic inhibition of viral replication, highlighting the potential of multi-antigen strategies informed by structural understanding .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.