Recombinant Bat coronavirus HKU3 Protein 3 (3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
3; Protein 3; Accessory protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Bat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3)
Target Names
3
Target Protein Sequence
MDLFMSIFTLGAITRNPAKIENASPASTVHATATIPLQATFPFGWLIVGVALLAVFQSAS KVIALHRRWQLALYKGVQLVCNMLLLFVTIYSHLLLLAACMEAQFLYIYALIYILQIVSF CRFIMRCWLCWKCRSKNPLLYDANYFVCWHTNNYDYCIPYNSVTDTVVITSGDGTNQPKL KEDYQIGGYSEDWHSGVKDYVVIYGYFTEVYYQLESTQLSTDTGAENATFFIYSKLVKDV DHVQIHTIDGSSGVVNPAMDPIYDEPTTTTSVPL
Uniprot No.

Target Background

Function
This protein forms homotetrameric potassium-sensitive ion channels (viroporins) and may modulate virus release. It upregulates the expression of fibrinogen subunits FGA, FGB, and FGG in host lung epithelial cells, induces apoptosis in cell culture, and downregulates the type 1 interferon receptor by inducing serine phosphorylation within the IFNα-receptor subunit 1 (IFNAR1) degradation motif and increasing IFNAR1 ubiquitination.
Subcellular Location
Virion. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein. Secreted. Host cytoplasm.

Q&A

How does the HKU3 Protein 3 compare to homologous proteins in other coronaviruses?

HKU3 Protein 3 shares approximately:

  • 42% amino acid identity with HCoV-NL63 NS3

  • 37% identity with BtCoV/512/05 NS3

  • 36% identity with PEDV NS3

  • 29% identity with TGEV NS3b

This moderate sequence conservation suggests some functional conservation among coronavirus accessory proteins while allowing for species-specific adaptations. No specific functional domains have been identified by protein family (PFAM) or InterProScan analyses , making its exact function still somewhat cryptic compared to the more well-characterized structural proteins.

What are the recommended expression systems for producing recombinant HKU3 Protein 3?

Several expression systems have been validated for producing recombinant HKU3 Protein 3:

Expression SystemAdvantagesConsiderations
BaculovirusHigher eukaryotic post-translational modifications; suitable for membrane proteinsLonger production time; higher cost
E. coliRapid production; high yield; cost-effectiveLimited post-translational modifications; potential folding issues with membrane proteins
YeastModerate post-translational modifications; good for secreted proteinsHyperglycosylation may affect function
Mammalian cellsMost native-like post-translational modificationsHighest cost; lower yields

For most basic research applications, baculovirus expression systems typically yield >85% purity as determined by SDS-PAGE . For studies requiring native conformation and post-translational modifications, mammalian expression systems may be preferable despite higher costs.

What methodologies are most effective for studying the membrane topology of HKU3 Protein 3?

Given the predicted three transmembrane domains in HKU3 Protein 3 , researchers should consider:

  • Cysteine accessibility methods: Substituting key residues with cysteine and assessing their accessibility to membrane-impermeable sulfhydryl reagents can map protein topology.

  • Fluorescence protease protection assay: Tagging the protein with GFP at different positions and measuring protection from protease digestion.

  • Glycosylation mapping: Introducing artificial N-glycosylation sites at various positions to determine luminal exposure.

  • Cryo-electron microscopy: For high-resolution structural analysis, particularly when expressed in native-like membranes.

  • MD simulations: Computational modeling of membrane insertion and orientation based on hydrophobicity plots and evolutionary conservation.

The transmembrane domains at positions 38-60, 81-103, and 118-140 should inform experimental design, with special consideration for detergent selection during purification .

What is the current understanding of HKU3 Protein 3's role in viral replication and pathogenesis?

While the specific functions of HKU3 Protein 3 remain incompletely characterized, research on homologous proteins in other coronaviruses suggests potential roles in:

  • Membrane rearrangement: Like other coronavirus accessory proteins, it may participate in remodeling cellular membranes to create viral replication compartments.

  • Host immune modulation: Accessory proteins often interfere with host immune responses, though specific mechanisms for HKU3 Protein 3 remain uncharacterized.

  • Virion assembly: Its transmembrane nature suggests possible involvement in virion morphogenesis at the ER-Golgi intermediate compartment.

Comparative studies indicate that while ORF3a proteins show some functional convergence across coronaviruses, they may also contribute to host adaptation and species-specific pathogenesis . Unlike some structural proteins, ORF3a shows greater sequence divergence between coronavirus species, which may reflect adaptation to different host environments.

How does HKU3 Protein 3 potentially contribute to cross-species transmission potential?

While the receptor-binding domain (RBD) of spike protein is the primary determinant of host range , accessory proteins like ORF3a may play supporting roles in cross-species transmission:

  • Accessory proteins can modulate virus-host interactions in a species-specific manner, potentially affecting viral fitness in new hosts.

  • Studies of SARS-CoV and related bat coronaviruses suggest that while the spike protein determines initial entry, accessory proteins may affect downstream replication efficiency and immune evasion .

  • The moderate sequence conservation of ORF3a between bat coronaviruses and human-infecting strains suggests that these proteins may undergo adaptive evolution during host switching events .

Researchers studying zoonotic potential should consider not only the spike protein interactions but also the potential adaptive changes in accessory proteins like ORF3 that might facilitate efficient replication in new host cells.

What techniques are most appropriate for identifying host cell interaction partners of HKU3 Protein 3?

For identifying host proteins that interact with HKU3 Protein 3, researchers should consider:

  • Proximity labeling techniques:

    • BioID or TurboID fusion proteins can biotinylate nearby proteins in living cells

    • APEX2 fusion for spatially-resolved proteomics

    • These approaches are particularly valuable for membrane-associated proteins like ORF3

  • Co-immunoprecipitation with cross-linking:

    • Chemical cross-linking before lysis can capture transient interactions

    • Sequential purification with different tags (e.g., His-tag, as available in commercial products ) can reduce background

  • Split reporter assays:

    • Bimolecular Fluorescence Complementation (BiFC)

    • Split luciferase complementation assays

    • Particularly useful for validating specific interactions in cellular contexts

  • Comparative interactome analysis:

    • Parallel analysis of ORF3 proteins from different coronaviruses

    • Can identify conserved vs. species-specific interactions

When interpreting results, researchers should account for the membrane topology of HKU3 Protein 3 with its three transmembrane domains , as this will constrain the orientation of potential interaction interfaces.

How can researchers effectively investigate the evolutionary conservation and divergence of Protein 3 within the Sarbecovirus subgenus?

To conduct robust evolutionary analyses of Protein 3 across sarbecoviruses:

  • Sequence collection and alignment:

    • Include diverse bat coronavirus sequences, particularly from HKU3, WIV1, and related strains

    • Align sequences using algorithms optimized for transmembrane proteins (e.g., MAFFT with the --localpair option)

  • Selection pressure analysis:

    • Calculate dN/dS ratios across the protein sequence to identify regions under positive or purifying selection

    • Use methods like FUBAR, MEME, or SLAC from the HyPhy package

  • Structure-guided comparative analysis:

    • Map conservation onto predicted structural models

    • Pay special attention to the transmembrane domains and regions exposed to cytoplasm or extracellular space

  • Recombination detection:

    • Analyze potential recombination events using methods like those in RDP5 software

    • The Sarbecovirus subgenus shows recombination hotspots at the junction of the spike protein and ORF1ab

Recent research has identified 425 recombination events across various coronavirus subgenera , suggesting that accessory proteins may be involved in these events that contribute to viral evolution and host adaptation.

How can recombinant HKU3 Protein 3 be utilized in studying potential zoonotic emergence patterns?

Recombinant HKU3 Protein 3 can serve as a valuable tool for investigating zoonotic potential through several approaches:

  • Comparative functional studies:

    • Express HKU3 Protein 3 alongside homologs from human-infecting viruses in various cell types

    • Assess differences in localization, stability, and effect on cellular processes

    • Such studies can reveal adaptations that might facilitate cross-species transmission

  • Chimeric protein analysis:

    • Create chimeric proteins combining domains from bat and human coronavirus ORF3 proteins

    • Test functionality in different host cell types

    • This approach parallels methods used for studying receptor-binding domains

  • Evolutionary modeling:

    • Use sequence data to construct ancestral sequences and track evolution

    • Express these reconstructed proteins to test functionality

    • Infer potential evolutionary pathways to human adaptation

These approaches complement studies with chimeric viruses while focusing specifically on accessory protein functions rather than whole-virus characteristics.

What biosafety considerations should researchers address when working with bat coronavirus proteins?

Although working with individual recombinant proteins generally presents lower biosafety risks than infectious viruses, researchers should still adhere to rigorous biosafety protocols:

  • Risk assessment:

    • Evaluate potential for functional reconstitution when combined with other viral components

    • Consider the protein's known or predicted functions in immune evasion or pathogenesis

  • Recommended containment:

    • Recombinant proteins alone: typically BSL-2 with enhanced precautions

    • When combined with other viral components: case-by-case assessment, potentially BSL-3

    • Full virus reconstruction work requires high containment (BSL-3) and institutional oversight

  • Institutional oversight:

    • Projects should be reviewed by Institutional Biosafety Committees

    • May require Dual Use Research of Concern evaluation for certain applications

  • Storage and disposal:

    • Secure storage with limited access

    • Inactivation before disposal according to institutional protocols

For context, studies involving chimeric bat coronaviruses like those described in result were conducted under strict institutional oversight, including IACUC approval (UNC permit no. A-3410-01) and biosafety committee review .

What are the optimal storage and handling conditions for recombinant HKU3 Protein 3 to maintain stability and activity?

Based on commercial product information and standard practices for similar viral proteins:

ParameterRecommended ConditionsNotes
Storage temperature-20°C to -80°CLong-term storage at -80°C provides better stability
Buffer compositionTris/PBS-based buffer with 5-50% glycerolHigher glycerol concentration (50%) for liquid formulations
Alternative formulationLyophilized with 6% trehalose, pH 8.0Provides extended shelf-life
StabilityLiquid form: up to 6 months at -20°C/-80°C
Lyophilized: up to 12 months at -20°C/-80°C
Aliquot to avoid freeze-thaw cycles
Working storageAt 4°C for up to one weekFor active experiments
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLAdd 5-50% glycerol for aliquots intended for freezing
ThawingRapid thawing at room temperature followed by storage on iceAvoid repeated freeze-thaw cycles

The transmembrane nature of HKU3 Protein 3 may require additional considerations, potentially including non-denaturing detergents to maintain native conformation if the protein is to be used in structural or functional studies rather than simply as an immunogen.

What analytical methods are most appropriate for validating the identity and integrity of recombinant HKU3 Protein 3?

To ensure the quality of recombinant HKU3 Protein 3 preparations, researchers should employ:

  • SDS-PAGE analysis:

    • Expected molecular weight: ~30 kDa (calculated from sequence)

    • Should show >85% purity for standard research-grade preparations

    • Western blotting with anti-His antibodies for tagged versions

  • Mass spectrometry:

    • Intact mass analysis to confirm molecular weight

    • Peptide mapping after proteolytic digestion for sequence coverage

    • Can identify potential post-translational modifications

  • Circular dichroism (CD) spectroscopy:

    • Assess secondary structure content

    • Useful for comparing batches and confirming proper folding

  • Size-exclusion chromatography:

    • Evaluate oligomeric state and aggregation

    • Particularly important for membrane proteins that may form multimers

  • Functional validation:

    • If specific activities are known, functional assays should be established

    • For membrane proteins, reconstitution in liposomes may be required for certain functional tests

Commercial preparations typically include quality control data demonstrating purity by SDS-PAGE and may include additional characterization depending on the supplier and grade of product .

How does the study of HKU3 Protein 3 contribute to understanding coronavirus recombination events?

Bat coronavirus HKU3 Protein 3 research contributes to our understanding of viral recombination through several key mechanisms:

  • Comparative sequence analysis:

    • Systematic comparison of ORF3 sequences across coronaviruses can reveal potential recombination breakpoints

    • Recent research has identified numerous recombination events in the Sarbecovirus subgenus

  • Molecular markers of evolutionary history:

    • Accessory proteins like ORF3 can serve as markers for tracking viral lineages

    • The distinctive evolution rates of these proteins compared to structural proteins provides complementary information about viral history

  • Functional consequences of recombination:

    • Expression and characterization of ORF3 variants can reveal how recombination events might affect protein function

    • This helps understand the fitness consequences of recombination

Research has shown that recombination hotspots in sarbecoviruses occur at the junction of the spike protein and ORF1ab , suggesting that accessory proteins may play a role in viral adaptation through recombination events.

What can comparative studies of HKU3 Protein 3 reveal about host adaptation mechanisms in coronaviruses?

Comparative studies of HKU3 Protein 3 and its homologs provide insights into viral adaptation through:

  • Host-specific functional adaptations:

    • Expression of bat vs. human coronavirus ORF3 proteins in different cell types can reveal functional differences

    • Variations in protein stability, localization, or interaction partners may indicate adaptations to specific host environments

  • Molecular evolution signatures:

    • Specific amino acid changes that correlate with host shifts may represent critical adaptations

    • Positive selection analysis can identify residues under selection pressure during host adaptation

  • Accessory protein roles in host range:

    • While spike protein RBD is the primary determinant of host range , accessory proteins may play supporting roles

    • HKU3 Protein 3 variants may contribute to viral fitness in different host environments

Studies of bat SARS-like coronaviruses have shown that while receptor binding is critical for cross-species transmission, additional adaptations in accessory proteins may be necessary for efficient replication in new hosts .

What approaches are most effective for developing antibodies against HKU3 Protein 3 for research applications?

For developing research-grade antibodies against HKU3 Protein 3:

  • Antigen design strategies:

    • Full-length protein: Challenging due to transmembrane domains, but provides comprehensive epitope coverage

    • Hydrophilic domains: Target predicted extracellular/cytoplasmic regions for improved immunogenicity

    • Synthetic peptides: Select unique, antigenic regions (typically 15-25 amino acids)

  • Expression and purification considerations:

    • His-tagged constructs facilitate purification and detection

    • For transmembrane proteins, consider membrane protein expression systems (e.g., cell-free systems with detergents)

  • Immunization protocols:

    • For polyclonal antibodies: Standard protocols with multiple boosts

    • For monoclonal antibodies: Consider phage display or single B-cell isolation approaches

  • Validation methods:

    • Western blotting against recombinant protein and viral lysates

    • Immunofluorescence in infected cells vs. cells expressing recombinant protein

    • Cross-reactivity testing against homologous proteins from related viruses

  • Applications in viral detection:

    • Antibodies against conserved regions may enable detection of novel sarbecoviruses

    • Paired antibodies targeting different epitopes can be used in sandwich ELISA formats

Commercial recombinant HKU3 Protein 3 preparations can serve as positive controls for antibody validation and as immunogens for antibody production.

How can researchers use HKU3 Protein 3 to study cross-reactive immune responses relevant to coronavirus immunity?

Recombinant HKU3 Protein 3 can be utilized to investigate cross-reactive immunity through:

  • T-cell epitope mapping:

    • Screen overlapping peptides spanning HKU3 Protein 3 against T cells from:

      • SARS-CoV-2 recovered individuals

      • SARS-CoV recovered individuals

      • Naive individuals

    • Identify conserved T-cell epitopes that might contribute to cross-protection

  • Antibody cross-reactivity studies:

    • Test sera from individuals exposed to different coronaviruses against HKU3 Protein 3

    • Compare binding profiles to homologous proteins from human coronaviruses

    • Identify potential cross-reactive epitopes

  • Immunoinformatic predictions:

    • Use computational approaches to predict potential cross-reactive epitopes

    • Validate predictions experimentally with synthetic peptides or recombinant proteins

  • Implications for vaccine design:

    • Cross-reactive epitopes may inform development of broadly protective vaccines

    • Understanding conserved vs. variable regions helps target stable antigenic sites

These approaches complement studies with structural proteins like spike and nucleocapsid, potentially revealing additional targets for broadly protective immunity across the Sarbecovirus subgenus.

What are the most significant knowledge gaps regarding HKU3 Protein 3 function and structure?

Despite available research, several critical knowledge gaps remain:

  • Precise molecular function:

    • The specific role of HKU3 Protein 3 in viral replication remains poorly characterized

    • Its contribution to virulence or host adaptation is largely unknown

    • Potential roles in immune evasion require further investigation

  • Three-dimensional structure:

    • No high-resolution structure exists for HKU3 Protein 3

    • Detailed structural information would facilitate understanding of function and evolution

    • Transmembrane nature makes structural determination challenging

  • Host protein interactions:

    • Comprehensive interactome studies are lacking

    • Species-specific interaction patterns could reveal adaptation mechanisms

    • Functional consequences of these interactions remain to be characterized

  • Evolution and selection:

    • Detailed analysis of selection pressures across the protein is needed

    • Understanding of how recombination affects accessory protein evolution

    • Characterization of convergent evolution patterns across coronavirus lineages

Addressing these gaps would significantly advance our understanding of coronavirus biology and potentially inform countermeasure development.

How might research on HKU3 Protein 3 contribute to pandemic preparedness efforts?

Research on HKU3 Protein 3 can enhance pandemic preparedness through:

  • Viral evolution surveillance:

    • Understanding accessory protein diversity in bat coronaviruses provides markers for surveillance

    • Changes in these proteins may signal adaptation to new hosts

    • Complement spike protein monitoring with accessory protein analysis

  • Therapeutic target identification:

    • If conserved functions are identified, accessory proteins could become targets for broad-spectrum antivirals

    • Inhibiting accessory protein functions might attenuate viral replication across multiple species

  • Immunogen design for vaccines:

    • Identifying conserved epitopes could inform next-generation vaccine design

    • Inclusion of accessory protein epitopes might broaden protection against emerging variants

  • Pathogenesis understanding:

    • Better understanding of how accessory proteins contribute to virulence

    • May help predict pathogenic potential of newly discovered viruses

Research on synthetic recombinant coronaviruses has demonstrated that studying viral components like HKU3 Protein 3 can provide insights into cross-species transmission mechanisms and potential emergence pathways, contributing valuable information to pandemic preparedness efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.