Recombinant Bat coronavirus HKU3 Protein 7a (7a)

Shipped with Ice Packs
In Stock

Description

Definition and Context

Protein 7a (7a) is a non-structural protein encoded by coronaviruses, including bat SARS-like coronaviruses (SARSr-CoVs). It is part of the viral genome but is not as extensively characterized as structural proteins like Spike (S) or Nucleocapsid (N). In SARS-CoV, Protein 7a has been shown to inhibit cellular protein synthesis and activate stress-response pathways (e.g., p38 MAP kinase) .

For bat coronaviruses like HKU3, Protein 7a likely shares functional similarities with its SARS-CoV counterpart, though specific studies on its recombinant form remain scarce. HKU3 is a SARSr-CoV identified in Rhinolophus bats, serving as a natural reservoir for zoonotic viruses .

Functional Role of Protein 7a in Coronaviruses

Protein 7a is implicated in modulating host cell responses to viral infection. Key findings include:

FunctionEvidenceSource
Inhibition of host protein synthesisDisruption of ribosomal activity, leading to translational arrest
Activation of p38 MAP kinaseInduction of stress responses, potentially aiding viral replication
Viral replication supportInteraction with other non-structural proteins (e.g., ORF6, ORF7b)

Genomic and Evolutionary Context of HKU3

HKU3 is closely related to SARS-CoV and other bat SARSr-CoVs. Recombination events involving HKU3 and other bat coronaviruses have been critical in shaping viral diversity:

Recombination EventImpactSource
ORF1b/M/N regionsGeneration of chimeric viruses with altered host tropism
S gene acquisitionAcquisition of receptor-binding motifs (e.g., ACE2 binding)
ORF8 gene exchangeModular evolution of accessory proteins influencing pathogenicity

Research Gaps and Challenges

Despite its potential significance, Protein 7a in HKU3 remains understudied:

  1. Lack of Direct Characterization

    • No peer-reviewed studies explicitly describe the recombinant expression, purification, or functional assays of HKU3 Protein 7a.

    • Most data on Protein 7a derive from SARS-CoV or other SARSr-CoVs .

  2. Structural and Functional Ambiguity

    • Limited crystallographic or cryo-EM data on 7a’s tertiary structure or interactions with host machinery.

    • Unclear whether HKU3 7a shares conserved motifs with SARS-CoV 7a (e.g., transmembrane domains).

  3. Recombination and Zoonotic Risk

    • HKU3 has participated in recombination events with other bat coronaviruses (e.g., Rp3, Rf1), raising questions about 7a’s role in cross-species transmission .

Comparative Analysis of Bat SARSr-CoV Proteins

The table below highlights genetic diversity in bat SARSr-CoVs, contextualizing HKU3’s position:

VirusHostKey FeaturesProtein 7a Status
HKU3Rhinolophus batsSARSr-CoV with recombination breakpoints in ORF1b/M/N Not explicitly studied
SHC014Rhinolophus sinicusClosely related to SARS-CoV, ORF8 divergence Analogous to SARS-CoV
RaTG13Rhinolophus affinisGenomic similarity to SARS-CoV-2, ORF8 absent Not characterized
SARS-CoVHumansProtein 7a inhibits translation, activates p38 MAPK Well-characterized

Proposed Research Directions

To advance understanding of HKU3 Protein 7a, the following approaches are recommended:

  1. Recombinant Expression

    • Cloning and expression of HKU3 7a in systems like E. coli or mammalian cells (e.g., HEK293) for purification and functional assays.

  2. Structural Biology

    • Cryo-EM or X-ray crystallography to resolve 7a’s structure and identify host interaction sites.

  3. Functional Screens

    • siRNA/knockout studies to test 7a’s role in viral replication and cytokine modulation.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
7a; Protein 7a; Accessory protein 7a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
16-122
Protein Length
Full Length of Mature Protein
Species
Bat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3)
Target Names
7a
Target Protein Sequence
ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCSSTHFAFACADGTRHTY QLRARSVSPKLFIRQEEVYQELYSPLFLIVAALVFIILCFTIKRKTE
Uniprot No.

Target Background

Function
Non-structural protein which is dispensable for virus replication in cell culture.
Subcellular Location
Virion. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein.

Q&A

What is the structural composition of coronavirus protein 7a?

Coronavirus protein 7a is a type I transmembrane protein consisting of approximately 122 amino acid residues, as characterized in SARS-CoV . The protein contains several distinct domains with specific functions:

  • N-terminal signal peptide (first 15 residues) that is cleaved by signal peptidase in both infected and transfected cells

  • Luminal domain (residues 16-96) that folds into a compact seven-stranded β sandwich structure resembling members of the immunoglobulin superfamily

  • Highly hydrophobic transmembrane domain (residues 97-117)

  • Short C-terminal tail containing an endoplasmic reticulum (ER) retention motif (KRKTE)

The luminal domain bears structural homology to ICAM-1, suggesting potential interaction capabilities with immune cell receptors . This domain has been crystallized and studied in detail, revealing its immunoglobulin-like fold that may contribute to its immunomodulatory functions.

How does protein 7a contribute to viral pathogenesis?

Protein 7a contributes to viral pathogenesis through multiple mechanisms, though it is not essential for viral replication:

  • Apoptosis induction: When overexpressed, protein 7a inhibits the growth of Balb/c 3T3 cells in both dose-dependent and time-dependent manners . This effect occurs through:

    • Cell cycle arrest at the G0/G1 phase by inhibiting phosphorylation of retinoblastoma (Rb) protein

    • Activation of caspase-dependent apoptotic pathways independent of MAPK pathways

  • Inflammatory response modulation: Protein 7a activates nuclear factor kappa B (NF-κB) and c-Jun N-terminal kinase (JNK), inducing production of pro-inflammatory cytokines including interleukin 8 (IL-8) and RANTES .

  • Cellular translation inhibition: Overexpression of protein 7a activates p38 mitogen-activated protein kinase (MAPK) and inhibits cellular protein synthesis at the translation level .

  • Immune evasion: In SARS-CoV-2, protein 7a has gained the ability to downregulate surface HLA class I expression, potentially allowing the virus to evade cytotoxic T cell responses .

Despite these pathogenic functions, deletion studies have shown that recombinant SARS-CoV with ORF7a deleted does not significantly affect viral replication efficiency in cell culture or in infected hamsters, indicating it is not essential for basic viral replication .

What are the functional domains of coronavirus protein 7a and their significance?

Coronavirus protein 7a contains several domains with distinct functions that together contribute to its role in viral pathogenesis:

  • Signal peptide (aa 1-15): Directs the protein to the ER during synthesis and is cleaved off in the mature protein . This processing is essential for proper protein localization and function.

  • Luminal domain (aa 16-96): Research has identified this as the primary functional domain with several key features:

    • Contains residues 44-82 that are essential for cytoplasmic localization and cell-cycle arrest capabilities

    • Forms an immunoglobulin-like fold that enables interaction with host immune components

    • In SARS-CoV-2, a single amino acid substitution (T59F) in this region confers the ability to downregulate HLA-I, representing a gain-of-function not present in SARS-CoV-1

  • Transmembrane domain (aa 97-117): Anchors the protein in cellular membranes and contributes to its localization pattern .

  • C-terminal tail with ER retention motif (KRKTE): Ensures proper subcellular localization. Mutation of this motif from KRKTE to ERETE results in failure of retro-transport to the ER, causing protein accumulation in the Golgi where it undergoes rapid proteolytic processing .

The interaction between these domains enables protein 7a to function in viral assembly and host-pathogen interactions. For example, the luminal domain's interaction capabilities combined with the ER retention motif allow protein 7a to physically interact with viral structural proteins like M and E, potentially serving roles in viral assembly .

How do mutations in protein 7a affect viral pathogenesis and host cell responses?

Mutations in protein 7a can significantly alter its functional properties and impact viral pathogenesis:

  • Signal peptide alterations: Replacement of the native signal peptide with alternative sequences (e.g., human CD8A signal peptide) does not impair the protein's ability to downregulate HLA-I in SARS-CoV-2, suggesting functional flexibility in this domain .

  • Luminal domain mutations: These can have profound effects on function:

    • The T59F substitution in SARS-CoV-1 ORF7a confers the ability to downregulate HLA-I surface expression, representing a critical gain-of-function mutation present in SARS-CoV-2

    • H62Q substitution induces minor HLA-I surface downregulation

    • A68P substitution shows no effect on HLA-I downregulation

  • ER retention motif mutations: Altering the C-terminal KRKTE motif to KAAAA (tail mutation) or completely deleting the transmembrane and cytoplasmic tail disrupts proper protein trafficking but does not impair HLA-I downregulation function .

These findings highlight how specific amino acid changes, particularly in the luminal domain, can significantly alter protein 7a's immunomodulatory properties. Researchers investigating bat coronavirus HKU3 protein 7a should focus on these key residues when analyzing potential functional differences between coronavirus strains.

The evolutionary acquisition of immune evasion capabilities through single amino acid substitutions demonstrates how subtle genetic changes can dramatically impact viral pathogenesis and potentially contribute to cross-species transmission events.

What methodological approaches are optimal for studying protein 7a interactions with host proteins?

Several methodological approaches have proven effective for studying protein 7a interactions with host proteins:

  • Recombinant protein expression systems:

    • Signal peptide replacement strategies can be employed to improve expression while maintaining function

    • Various expression vectors and cell lines (293T, Vero E6, Caco2) have been successfully used for protein 7a studies

  • Protein interaction studies:

    • Direct in vitro binding experiments in Jurkat cells have confirmed interaction between SARS-CoV p7a and LFA-1, suggesting methodological applicability for studying other potential interactions

    • Co-immunoprecipitation studies have demonstrated physical interaction between SARS-CoV p7a and the host protein small glutamine-rich tetratricopeptide repeat-containing protein (SGT)

  • Functional assays:

    • Flow cytometry to assess surface HLA-I expression levels following protein 7a expression

    • Cell cycle analysis to measure G0/G1 phase arrest

    • Protein phosphorylation assays to detect inhibition of Rb protein phosphorylation

    • Cytokine production measurement following NF-κB and JNK activation

  • Mutation and chimeric protein analysis:

    • Creating chimeric proteins between SARS-CoV-1 and SARS-CoV-2 ORF7a to identify functional domains

    • Site-directed mutagenesis to introduce specific amino acid changes and assess their functional impact

For bat coronavirus HKU3 protein 7a research, these methodological approaches provide a framework for investigating protein-protein interactions and functional properties through comparative analysis with better-characterized coronavirus homologs.

How does protein 7a interact with the host immune system?

Protein 7a employs multiple mechanisms to interact with and modulate the host immune system:

  • HLA class I downregulation: SARS-CoV-2 protein 7a, but not SARS-CoV-1 protein 7a, downregulates surface expression of HLA class I molecules, potentially enabling evasion of CD8+ T cell responses . This function depends critically on a single amino acid (F59) in the luminal domain .

  • LFA-1 interaction: The structural homology between SARS-CoV protein 7a and ICAM-1 enables interaction with lymphocyte function-associated antigen 1 (LFA-1) on human leukocytes . This interaction has been confirmed through direct in vitro binding experiments in Jurkat cells and suggests LFA-1 may serve as an attachment factor or receptor for SARS-CoV on leukocytes .

  • Pro-inflammatory cytokine induction: Protein 7a activates NF-κB and JNK signaling pathways, inducing production of pro-inflammatory cytokines including IL-8 and RANTES . This activity potentially contributes to the cytokine storm observed in severe coronavirus infections.

  • MAPK pathway activation: Protein 7a activates the p38 MAPK pathway, which plays important roles in immune cell function and inflammatory responses .

Understanding these immune interaction mechanisms is crucial for researchers studying bat coronavirus HKU3 protein 7a, as variation in these properties may influence species-specific pathogenicity and zoonotic potential.

How does protein 7a contribute to viral assembly and replication?

While protein 7a is not essential for viral replication, evidence suggests it contributes to viral assembly processes:

  • Intracellular localization pattern: Protein 7a localizes to the ER and ER-Golgi intermediate compartment (ERGIC), which are the primary sites of coronavirus assembly . This localization pattern is similar to the M protein of other coronaviruses .

  • Interaction with viral structural proteins: Protein 7a physically interacts with SARS-CoV M and E proteins, which are critical components of the viral assembly machinery . These interactions suggest protein 7a may serve an accessory function during viral assembly.

  • Incorporation into viral particles: The protein has been detected in purified SARS-CoV virions, indicating it may be a minor structural component of the virus .

  • Post-translational modifications: Protein 7a can be O-glycosylated, transforming from a 31-kDa unmodified form to a 33-kDa modified form . Two different forms (37-kDa protein 3a-1 and 31-kDa protein 3a-2) have been detected in infected cell supernatants, with the 37-kDa form associated with virus particle fractions .

Despite these assembly-related functions, deletion studies have consistently shown that protein 7a is dispensable for viral replication both in vitro and in vivo . Recombinant SARS-CoV with ORF7a deleted produces viral particles with similar morphology as wild-type virus and replicates similarly in transgenic mice expressing the SARS-CoV receptor .

The non-essential nature of protein 7a for basic replication suggests it primarily serves accessory functions that may enhance viral fitness in specific host environments or contribute to pathogenesis through host-pathogen interaction mechanisms rather than direct replication processes.

What are the evolutionary implications of protein 7a sequence variations across coronavirus species?

The evolutionary pattern of protein 7a across coronavirus species reveals important insights into viral adaptation and host-pathogen coevolution:

  • Functional divergence through minimal sequence changes: The comparison between SARS-CoV-1 and SARS-CoV-2 protein 7a demonstrates how a single amino acid substitution (T59F) can confer significant new immunomodulatory functions . This finding highlights how coronaviruses can rapidly acquire new host interaction capabilities through minimal genetic changes.

  • Conserved structural elements: Despite sequence variations, the core structure of protein 7a (immunoglobulin-like fold in the luminal domain, type I transmembrane orientation, ER retention signal) remains conserved across betacoronaviruses . This conservation suggests fundamental functional constraints on protein evolution.

  • Species-specific adaptations: The three primary regions of sequence difference between SARS-CoV-1 and SARS-CoV-2 protein 7a (signal sequence, luminal domain, and stalk-TM region) likely represent adaptation to different host environments or immune pressures .

For researchers studying bat coronavirus HKU3 protein 7a, comparative sequence analysis focusing on these critical variation hotspots could provide insights into:

  • Potential immune evasion capabilities

  • Host adaptation signatures

  • Cross-species transmission potential

  • Evolutionary relationship to human-infecting coronaviruses

The observed gain-of-function mutation (T59F) between SARS-CoV-1 and SARS-CoV-2 suggests that monitoring similar positions in bat coronavirus protein 7a sequences could help identify strains with enhanced potential for immune evasion should cross-species transmission occur.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.