Recombinant Bat coronavirus HKU4 Membrane protein (M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-219
Protein Length
full length protein
Species
Bat coronavirus HKU4 (BtCoV) (BtCoV/HKU4/2004)
Target Names
M
Target Protein Sequence
MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPAS MALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLN VPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKM VKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA
Uniprot No.

Target Background

Function

A viral envelope component crucial for virus morphogenesis and assembly through its interactions with other viral proteins.

Database Links

KEGG: vg:4835996

Protein Families
Betacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

How is the HKU4 Membrane protein structurally characterized?

The Membrane (M) protein of Bat coronavirus HKU4 is one of the major structural proteins essential for virus assembly and budding. While the search results don't provide specific details on HKU4 M protein structure, coronavirus M proteins typically feature three transmembrane domains, a short amino-terminal ectodomain exposed outside the virion, and a larger carboxy-terminal endodomain inside the virion. For recombinant expression studies, researchers have successfully isolated and characterized HKU4 using human colorectal adenocarcinoma (Caco-2) cells, which could facilitate the production of recombinant M protein for structural studies . Characterization methods would include western blotting (as demonstrated with spike proteins in these studies) and other protein analysis techniques to evaluate expression, folding, and post-translational modifications.

What cell systems are suitable for expression of recombinant HKU4 Membrane protein?

Based on research with intact HKU4 virus, several cell systems have demonstrated compatibility with HKU4 proteins. Caco-2 cells (human colorectal adenocarcinoma) have been successfully used to isolate and propagate HKU4, showing cytopathic effects during the first blind passage, indicating they support viral replication and protein expression . Additionally, Huh7 (human hepatoma) cells have demonstrated efficient HKU4 replication . For recombinant expression specifically, HEK293T cells have been used successfully to express HKU4 spike proteins for pseudovirus production, suggesting they might also be suitable for M protein expression . When designing expression systems, researchers should consider codon optimization for the target cell line and appropriate purification tags that won't interfere with protein structure or function.

What are the recommended protocols for purifying recombinant HKU4 Membrane protein?

For purification of recombinant HKU4 M protein, researchers should implement a multi-step approach beginning with optimization of expression conditions. Based on protocols used for other coronavirus proteins:

  • Expression system selection: While the search results don't specify purification protocols for HKU4 M protein specifically, researchers have successfully expressed coronavirus proteins in systems including Caco-2 and HEK293T cells .

  • Affinity purification: Engineer constructs with purification tags (His-tag or FLAG-tag) for initial capture. FLAG epitope tags have been successfully used with HKU4 S protein and detected via western blotting .

  • Protein solubilization: Since M is a membrane protein, optimal detergent selection is critical. Commonly used detergents include DDM (n-dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) at concentrations above their critical micelle concentration.

  • Secondary purification: Size exclusion chromatography to separate properly folded protein from aggregates.

  • Quality control: Assess protein purity via SDS-PAGE and western blotting, and verify structural integrity using circular dichroism.

The purified protein should be stored in buffer conditions that maintain stability, typically including detergent at concentrations just above CMC.

How can researchers evaluate the interaction between recombinant HKU4 M protein and other viral components?

To evaluate interactions between recombinant HKU4 M protein and other viral components, researchers can employ multiple complementary techniques:

  • Co-immunoprecipitation (co-IP): This approach has been successfully used to evaluate interactions between HKU4-RBD and various DPP4 proteins . For M protein interaction studies, researchers would express tagged M protein along with other viral proteins of interest, then use antibodies against the tag to pull down protein complexes.

  • Surface plasmon resonance (SPR): This technique provides quantitative binding kinetics data and has been applied to study HKU4-RBD interactions with receptors . For M protein studies, the recombinant protein would be immobilized on a sensor chip surface while potential binding partners flow over it.

  • Biolayer interferometry (BLI): An alternative to SPR that also provides real-time interaction data.

  • Fluorescence resonance energy transfer (FRET): By tagging M protein and potential interaction partners with compatible fluorophores, researchers can monitor proximity-dependent energy transfer as evidence of interaction.

  • Cryo-electron microscopy: For structural characterization of M protein complexes within virus-like particles.

These methodologies can reveal not only which viral components interact with M protein but also the strength, specificity, and structural basis of these interactions.

What cell-based assays can assess functional properties of recombinant HKU4 M protein?

To assess the functional properties of recombinant HKU4 M protein, researchers can implement several cell-based assays:

  • Virus-like particle (VLP) formation assays: Co-express M with other structural proteins (E, N) to assess its ability to drive particle assembly and budding. Quantify VLP production by ultracentrifugation followed by western blotting or electron microscopy.

  • Subcellular localization studies: Use fluorescently tagged M protein to track its distribution in mammalian cells, with particular attention to Golgi apparatus localization, which is typical for coronavirus M proteins.

  • Membrane topology analysis: Employ protease protection assays combined with domain-specific antibodies to confirm the predicted topology of M protein in cellular membranes.

  • Protein-protein interaction assays in cells: Use techniques such as proximity ligation assay (PLA) or split complementation assays (BiFC) to visualize and quantify M protein interactions with other viral or host proteins in a cellular context.

  • Effect on cellular pathways: Assess how M protein expression affects cellular pathways such as the secretory pathway, inflammatory responses, or interferon signaling through transcriptomics, proteomics, or reporter assays.

These assays provide complementary information about M protein function in a more physiologically relevant context than in vitro biochemical assays alone.

How does the HKU4 M protein compare structurally and functionally with MERS-CoV M protein?

Comparative analysis of HKU4 and MERS-CoV M proteins can reveal evolutionary adaptations that may contribute to differing host ranges and pathogenicity. While specific comparative data for M proteins is not provided in the search results, the evolutionary relationship between these viruses suggests both conservation and divergence patterns:

  • Sequence homology: Given that full-genome comparison shows 75.3-81.2% nucleotide identity between HKU4 and MERS-CoV , M proteins likely share significant homology but with key differences.

  • Host adaptation signatures: MERS-CoV has adapted to efficiently use human cellular machinery, whereas HKU4 shows preferences for bat cellular factors . These differences likely extend to the M protein, potentially in regions interacting with host factors.

  • Functional differences: MERS-CoV enters human cells more efficiently than HKU4 , which may partially relate to differences in structural protein interactions during viral assembly and budding.

Methodologically, researchers should approach this comparison through:

  • Sequence alignment and evolutionary analysis to identify conserved vs. divergent regions

  • Structural modeling and prediction tools to generate comparative models

  • Recombinant expression of both proteins for direct functional comparison in identical systems

  • Chimeric protein construction to map functional domains

These approaches can identify key residues that may contribute to host adaptation or pathogenicity differences.

What role does the HKU4 M protein play in recombination events between bat coronaviruses?

The role of the M protein in coronavirus recombination is complex and potentially significant, though the search results don't provide direct evidence of M protein involvement in HKU4 recombination specifically. Recombination analysis has revealed that some MERS-related CoVs have acquired their spike genes from DPP4-recognizing bat coronavirus HKU4 , indicating that recombination between HKU4 and other bat coronaviruses occurs in nature.

The methodological approach to investigating M protein's role in recombination would include:

  • Genomic analysis: Examine sequences from multiple bat coronaviruses to identify potential recombination breakpoints around the M gene through tools like RDP4, SimPlot, or Bootscan.

  • Experimental recombination systems: Develop cell culture systems that express multiple coronavirus genomes to study recombination frequency and preferred breakpoints.

  • Structural analysis: Determine whether M protein interactions with viral RNA or other proteins create "hotspots" for recombination.

  • Evolutionary pressure analysis: Calculate selection pressures (Ka/Ks ratios) on the M gene compared to other viral genes to understand its evolutionary constraints.

Understanding the M protein's role in recombination events provides insight into coronavirus evolution and potential emergence of novel coronaviruses with pandemic potential.

How can recombinant HKU4 M protein be utilized in developing coronavirus detection methods?

Recombinant HKU4 M protein offers significant potential for coronavirus detection method development, particularly for identifying MERS-related coronaviruses. Methodological approaches include:

  • Antibody development: M proteins are relatively conserved among related coronaviruses and can elicit antibodies for detection. By immunizing animals with purified recombinant HKU4 M protein, researchers can develop polyclonal or monoclonal antibodies that may cross-react with related coronaviruses. These antibodies can be incorporated into:

    • Enzyme-linked immunosorbent assays (ELISAs)

    • Lateral flow assays for rapid detection

    • Immunofluorescence assays for tissue or cell culture samples

  • Antigen detection systems: Direct detection of M protein in clinical samples using capture antibodies specific to conserved epitopes.

  • PCR primer/probe design: While not using the protein directly, recombinant M protein expression and characterization can identify conserved regions for designing primers and probes for PCR-based detection systems.

  • Multiplex detection platforms: Integration of M protein-based detection alongside other coronavirus markers (like N protein) to improve specificity and sensitivity.

These approaches could help surveillance efforts to monitor MERS-like coronaviruses in bat populations and potential intermediate hosts, providing early warning systems for potential zoonotic transmission events.

Does the HKU4 M protein contribute to species-specific receptor recognition?

While the spike (S) protein is the primary determinant of receptor recognition in coronaviruses, the M protein may indirectly influence this process through its interactions with S protein. Based on the available information:

  • Direct receptor binding: The search results clearly indicate that the spike protein RBD (receptor-binding domain) of HKU4 binds to DPP4 receptors , similar to MERS-CoV, but there is no evidence suggesting direct M protein involvement in receptor binding.

  • Potential indirect effects: The M protein could influence receptor binding through:

    • Stabilization of S protein conformation through M-S interactions

    • Effects on virus assembly that impact S protein incorporation or orientation in virions

    • Potential influence on S protein processing or trafficking within infected cells

  • Methodological approaches to investigate this question would include:

    • Co-expression studies of M and S proteins to assess potential conformational effects

    • Mutagenesis of M protein domains that interact with S protein

    • Comparative analysis of M proteins from viruses with different receptor preferences

    • Creation of chimeric viruses with heterologous M proteins to assess impact on receptor usage

These studies would help clarify whether M protein adaptations contribute to the observed preference of HKU4 for bat DPP4 over human DPP4 .

What host cell factors interact with recombinant HKU4 M protein during viral replication?

Understanding host cell factor interactions with HKU4 M protein requires systematic identification and characterization methods:

  • Proximity-based labeling approaches: BioID or APEX2 tagging of M protein to identify proximal proteins in the cellular environment.

  • Affinity purification-mass spectrometry (AP-MS): Pull-down of M protein complexes from transfected or infected cells followed by mass spectrometry to identify interacting partners.

  • Yeast two-hybrid or mammalian two-hybrid screens: Systematic identification of binary protein-protein interactions.

  • RNA-protein interaction studies: CLIP-seq or similar methods to identify if M protein interacts with specific host RNA species.

  • Functional genomics: CRISPR screens in susceptible cells to identify host factors essential for M protein function.

Based on knowledge of other coronavirus M proteins, likely interaction partners include:

  • Cellular trafficking proteins (particularly those involved in Golgi processing)

  • Components of the ESCRT (Endosomal Sorting Complexes Required for Transport) machinery

  • Host restriction factors that may inhibit viral replication

  • Membrane-remodeling proteins involved in virion assembly

Comparing these interactions across bat and human cells would provide insight into potential species-specific adaptations in virus-host interactions.

Can recombinant HKU4 M protein serve as a vaccine antigen against MERS-CoV?

The potential of recombinant HKU4 M protein as a MERS-CoV vaccine antigen is complex and requires careful consideration:

  • Cross-reactivity potential: While HKU4 is related to MERS-CoV, specific cross-reactivity data for the M protein is not provided in the search results. The level of amino acid conservation between HKU4 and MERS-CoV M proteins would determine the likelihood of cross-protective immune responses.

  • M protein as a vaccine target: Coronavirus M proteins are generally:

    • Abundant in virions

    • Relatively conserved compared to spike proteins

    • Capable of eliciting T-cell responses and potentially neutralizing antibodies

  • Methodological approach to evaluate vaccine potential:

    • Expression and purification of recombinant HKU4 M protein with native conformation

    • Immunization studies in animal models to evaluate antibody and T-cell responses

    • Measurement of cross-reactive antibodies against MERS-CoV M protein

    • Challenge studies in appropriate animal models to assess protection

    • Comparison with S protein-based vaccines, which are typically more potent at eliciting neutralizing antibodies

  • Potential advantages: Using HKU4 M protein might provide broader protection against multiple members of the MERS-like coronavirus clade, potentially including emerging variants.

  • Limitations: M protein-based vaccines typically induce lower levels of neutralizing antibodies compared to S protein-based vaccines, potentially requiring adjuvants or combination with other viral antigens.

Research would need to determine whether HKU4 M protein could elicit sufficient cross-protective immunity to be valuable as a MERS-CoV vaccine component.

What techniques can assess cross-reactivity between antibodies against HKU4 M protein and other coronavirus M proteins?

To assess cross-reactivity between antibodies against HKU4 M protein and other coronavirus M proteins, researchers can employ multiple complementary techniques:

  • Enzyme-Linked Immunosorbent Assay (ELISA):

    • Coat plates with recombinant M proteins from different coronaviruses

    • Test binding of anti-HKU4 M antibodies across concentration ranges

    • Determine relative binding affinities and cross-reactivity patterns

    • This approach can provide quantitative comparison of antibody recognition

  • Western Blotting:

    • Express recombinant M proteins from multiple coronaviruses

    • Probe with anti-HKU4 M antibodies

    • Assess binding to denatured proteins, indicating linear epitope recognition

  • Flow Cytometry:

    • Express different coronavirus M proteins on cell surfaces

    • Measure antibody binding via fluorescently labeled secondary antibodies

    • This method has been successfully applied to study HKU4 RBD binding to cells

  • Surface Plasmon Resonance (SPR):

    • Immobilize recombinant M proteins on sensor chips

    • Measure binding kinetics of anti-HKU4 M antibodies

    • Determine association/dissociation rates and binding affinities

    • SPR has been successfully used for coronavirus protein interaction studies

  • Peptide Arrays:

    • Synthesize overlapping peptides covering M protein sequences from different coronaviruses

    • Identify specific cross-reactive epitopes recognized by anti-HKU4 M antibodies

These techniques would elucidate both the extent of cross-reactivity and the specific regions of the M protein responsible for shared epitopes.

What are the common challenges in expressing and purifying recombinant HKU4 M protein?

Expression and purification of recombinant coronavirus M proteins, including HKU4 M protein, present several technical challenges:

  • Membrane protein solubility: As an integral membrane protein with multiple transmembrane domains, the M protein has hydrophobic regions that can cause aggregation during expression and purification. Methodological solutions include:

    • Optimization of detergent type and concentration (typically using mild detergents like DDM, LMNG, or digitonin)

    • Testing different solubilization conditions (temperature, pH, salt concentration)

    • Consideration of fusion partners or solubility tags

  • Expression system selection: While HKU4 has been successfully propagated in Caco-2 and Huh7 cells , expression of recombinant M protein might require system optimization:

    • Mammalian expression systems (HEK293T, which has been used for HKU4 S protein )

    • Insect cell systems (Sf9, High Five)

    • Cell-free expression systems for direct incorporation into nanodiscs or liposomes

  • Protein yield: M proteins often express at lower levels than soluble proteins. Strategies to improve yield include:

    • Codon optimization for the expression host

    • Inducible expression systems with optimized induction parameters

    • Scale-up approaches like bioreactor cultivation

  • Protein stability: Maintaining native conformation during purification requires careful buffer optimization:

    • Screening buffer components (pH, salt, additives)

    • Inclusion of stabilizing lipids

    • Rapid purification workflows to minimize exposure time

  • Quality control: Verifying proper folding is challenging for membrane proteins. Approaches include:

    • Circular dichroism to assess secondary structure content

    • Limited proteolysis to probe folding state

    • Functional assays to verify biological activity

These challenges require systematic optimization and often necessitate protein engineering approaches to obtain sufficient quantities of properly folded protein.

How can researchers verify the structural integrity of purified recombinant HKU4 M protein?

Verifying the structural integrity of purified recombinant HKU4 M protein requires multiple complementary approaches:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content and compare with predicted values for coronavirus M proteins

    • Thermal stability assays (thermal shift assays or differential scanning calorimetry) to assess protein folding and stability

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to verify monodispersity and oligomeric state

  • Functional analysis:

    • Binding assays with known M protein interaction partners (e.g., other viral structural proteins)

    • Reconstitution into liposomes to assess membrane insertion

    • Virus-like particle formation assays when co-expressed with other structural proteins

  • Structural verification:

    • Negative-stain electron microscopy to assess gross structural features

    • Cryo-electron microscopy for higher-resolution structural assessment

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe protein dynamics and accessibility

  • Epitope accessibility:

    • Antibody binding assays using conformation-specific antibodies

    • Limited proteolysis combined with mass spectrometry to identify protected regions

  • Computational validation:

    • Comparison of experimental data with molecular dynamics simulations

    • Structure prediction validation using experimental constraints

These methods collectively provide a comprehensive assessment of whether the recombinant protein maintains its native structure, which is essential for reliable functional studies and applications.

Data Table: Comparative Analysis of HKU4 and MERS-CoV Characteristics

FeatureBat Coronavirus HKU4MERS-CoVMethodological ApproachReference
Genome Identity-75.3-81.2% nucleotide identity with MERS-related CoVsFull-genome sequencing and alignment
Host Cell TropismReplicates efficiently in Caco-2 and Huh7 cellsBroader human cell tropismVirus isolation and cell infection studies
Receptor PreferencePrefers bat DPP4 over human DPP4Prefers human DPP4 over bat DPP4Flow cytometry, Co-IP, SPR
Human Cell EntryRequires exogenous proteases for human cell entryCan enter human cells without exogenous proteasesPseudovirus entry assays
Spike Protein ProcessingLargely intact in pseudovirusesMajority proteolytically cleavedWestern blotting
Animal Model InfectionCan infect hDPP4-transgenic mice with self-limiting diseaseSevere disease in hDPP4-transgenic miceAnimal infection studies
Recombination EvidenceDonor of spike genes to other MERS-related CoVs-Recombination analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.