Recombinant Bat coronavirus HKU4 Non-structural protein 3d (3d)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs unless dry ice shipping is specifically requested and arranged in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
3d; Non-structural protein 3d; ns3d; Accessory protein 3d
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Bat coronavirus HKU4 (BtCoV) (BtCoV/HKU4/2004)
Target Names
3d
Target Protein Sequence
MAFSASLFRTKTVHTEDAFCPRSAIQAEQPPNIIDCIPVAGYEAALITNALFLLVLFVFN PLTCKGNWIKAILFYSLLLYNMILAIFLVVDTQHFVSALLLAYVVTFLVLWTADRIRLSC AVGSVLPFVDMRSSYIRVDNGNSSVVVPMNHTKHWFIRNFEQSCHCENCFYIHSSSYVEC TFISRLKKSILVSVCDFSLGGNVSTVFVPSSDKTVPLHIIAPSKLYV
Uniprot No.

Target Background

Database Links

KEGG: vg:4835995

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of Bat coronavirus HKU4 Non-structural protein 3d (3d)?

Bat coronavirus HKU4 Non-structural protein 3d (also referred to as HKU4 SUD-C or the C domain of the SARS-Unique Domain) has been structurally characterized as having a frataxin fold. This structure consists of 5 antiparallel β strands packed against 2 α helices . The structure was determined using NMR spectroscopy and deposited in the Protein Data Bank under accession code 6MWM . The domain is part of the larger nonstructural protein 3 (nsp3), which is implicated in viral replication, polyprotein cleavage, and host immune interference .

What expression systems are most effective for producing recombinant HKU4 nsp3d?

The recombinant expression of HKU4 nsp3d has been successfully achieved using E. coli expression systems. According to the research data, uniformly 15N, 13C-labeled HKU4 C domain was expressed and purified from E. coli with domain boundaries predicted using secondary structure prediction tools (Jpred) and multiple sequence alignment (Fold and Function Assignment System) . The construct typically includes residues 1445 to 1522 of nsp3 with a 6xHis fusion tag to facilitate purification . Similar expression protocols have been used for other HKU4 nonstructural proteins, suggesting this is a reliable approach .

What purification methods yield the highest purity of recombinant HKU4 nsp3d?

For optimal purification of recombinant HKU4 nsp3d, a combination of affinity chromatography and gel filtration chromatography has been employed. The protein can be purified to homogeneity using these methods, as demonstrated in gel filtration experiments . The purified protein exhibits homogeneous peak distributions and intensities suitable for NMR characterization . Recommended storage conditions include keeping the protein at -20 to -80°C, preferably in aliquots to avoid repeated freeze-thaw cycles. A suitable storage buffer consists of 50mM Tris-HCl (pH 7.5), 200mM NaCl, and 20% glycerol .

What experimental techniques are most suitable for studying HKU4 nsp3d-protein interactions?

NMR spectroscopy has proven to be particularly effective for studying protein-protein interactions involving HKU4 nsp3d. Specifically, chemical shift perturbation experiments can detect interactions between HKU4 nsp3d and other domains, such as the neighboring M domain . The methodology involves:

  • Recording HSQC spectra of individual domains and didomain constructs

  • Comparing chemical shifts to identify perturbed residues

  • Mapping perturbations onto the protein structure to identify interaction interfaces

Additionally, 15N{1H}-NOE experiments have been used to investigate the flexibility of linker regions between domains, providing insights into the dynamics of domain-domain interactions .

How do protein-protein interactions between HKU4 nsp3d and other domains contribute to viral function?

HKU4 nsp3d engages in significant protein-protein interactions with the nearby M domain of nsp3, as evidenced by NMR chemical shift perturbation experiments . When comparing the HSQC spectra of HKU4 C (nsp3d) alone versus within a didomain construct with the M domain, 31 residues in HKU4 C experienced chemical shift perturbations greater than or equal to 0.022 ppm . These perturbations were most intense on the conserved face of the protein, suggesting this region serves as the interaction interface.

Additionally, 50 residues in the M domain experienced perturbations greater than or equal to 0.008 ppm when in the didomain construct . These interactions are likely functionally important as the residues involved are conserved specifically in group 2c coronaviruses, indicating evolutionary preservation of this interaction .

While the exact function of this interaction remains to be fully elucidated, the nsp3 protein has been implicated in viral replication, polyprotein cleavage, and host immune interference . Therefore, these domain-domain interactions may play critical roles in coordinating these functions during viral infection.

What biophysical methods can be optimized for studying the dynamic properties of HKU4 nsp3d?

Several NMR techniques have been optimized for studying the dynamic properties of HKU4 nsp3d:

TechniqueApplicationOptimization Parameters
Triple resonance experiments (HNCA, HNCOCA, HNCACB, CBCA(CO)NH, HNCO)Backbone assignment600-850 MHz 1H frequencies with cryoprobes
3D 13C-resolved NOESYSide chain assignmentAliphatic and aromatic variants
3D 15N-resolved NOESYStructure determinationComputational analysis with ASCAN
15N{1H}-NOE experimentsFlexibility analysisBruker 600 MHz, processed with Bruker Dynamics Center
Chemical shift perturbationInteraction mappingCalculated with scaling coefficient for 15N shifts

For optimal results, NMR samples should be prepared at 2.0-3.0 mM protein concentration with 3% D2O (v/v) and 0.02% NaN3 (w/v) . Experiments are best conducted on high-field spectrometers (600-850 MHz 1H frequencies) equipped with cryoprobes .

How does the SUD-C domain of HKU4 compare functionally with macrodomains in other regions of nsp3?

While the SUD-C domain (nsp3d) and macrodomains share the common feature of being part of nsp3, they exhibit distinct structures and functions:

  • Fold comparison: The HKU4 SUD-C domain adopts a frataxin fold , whereas macrodomains typically display an α/β/α sandwich fold .

  • Ligand binding: Macrodomains, such as those found in MERS-CoV and related viruses, bind ADP-ribose and related metabolites . For instance, the HKU4 macrodomain has a binding affinity of 14 μM for ADP-ribose . In contrast, there is no evidence that the SUD-C domain binds nucleotides or ADP-ribose.

  • Enzymatic activity: Macrodomains often possess deMARylating (removal of mono-ADP-ribose) activity . The HKU4 macrodomain shows hydrolase activity that is affected by mutations in key residues like G351L and I434A . The SUD-C domain has not been reported to possess enzymatic activity.

  • Protein interactions: The SUD-C domain primarily engages in protein-protein interactions with the neighboring M domain of nsp3 , whereas macrodomains interact with host factors involved in ADP-ribosylation pathways.

Understanding these functional differences is crucial for developing targeted antiviral strategies that exploit the unique properties of each domain.

What role might HKU4 nsp3d play in cross-species transmission potential?

While the direct role of HKU4 nsp3d in cross-species transmission is not explicitly detailed in the search results, the broader context of HKU4 proteins in transmission potential provides important insights:

HKU4, a bat coronavirus genetically related to MERS-CoV, demonstrates significant cross-species transmission potential. Specifically:

Given that nsp3 is implicated in viral replication, polyprotein processing, and host immune interference , it's reasonable to hypothesize that nsp3d might contribute to these species-specific adaptations. The conserved nature of SUD-C domain interactions within group 2c coronaviruses suggests that these protein-protein interactions may be important for maintaining viral fitness during cross-species transmission events .

How might mutations in conserved residues of HKU4 nsp3d affect viral fitness?

Based on structural and functional analyses of HKU4 proteins, we can predict that mutations in conserved residues of nsp3d could significantly impact viral fitness through several mechanisms:

Research involving targeted mutagenesis of these conserved residues, followed by functional assays and structural analyses, would be necessary to fully understand their impact on viral fitness.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.