Recombinant Bat coronavirus HKU5 Membrane protein (M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer's requirements.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize development according to your specifications.
Synonyms
M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-220
Protein Length
full length protein
Species
Bat coronavirus HKU5 (BtCoV) (BtCoV/HKU5/2004)
Target Names
M
Target Protein Sequence
MASSNVTLSNDEVLRLVKDWNFTWSVVFLLITIVLQYGYPSRSMFVYVIKMFVLWLLWPA SMALSIFCAVYPIDLASQIISGILAATSCAMWISYFVQSIRLFMRTGSWWSFNPESNCLL NVPIGGTTVVRPLVEDSTSVTAVVTDGYLKMAGMHFGACDFQRLPSEVTVAKPNVLIALK MIKRQAYGTNSGVAIYHRYKAGNYRRPPIIQDQELALLRA
Uniprot No.

Target Background

Function
A viral envelope component crucial for virus morphogenesis and assembly through interactions with other viral proteins.
Database Links

KEGG: vg:4836001

Protein Families
Betacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the structure of the HKU5 Membrane (M) protein and how does it compare to other coronavirus M proteins?

The HKU5 M protein represents the first solved crystal structure of a betacoronavirus M protein. According to recent structural studies, the M protein from Pipistrellus bat coronavirus HKU5 (batCOV5-M) is closely related to MERS-CoV, SARS-CoV, and SARS-CoV-2 M proteins . The protein exhibits a distinctive fold that serves as a structural framework for virus assembly. The M protein is the most abundant structural protein in coronaviruses and features transmembrane domains that anchor it in the viral envelope.

Analysis of the crystal structure reveals specific binding domains that facilitate interactions with other viral proteins, particularly the nucleocapsid (N) protein. The carboxy-terminus of the batCOV5 N protein mediates its interaction with batCOV5-M, which provides insight into the mechanism of M protein-mediated assembly .

What methodologies are recommended for expressing and purifying recombinant HKU5 M protein for structural studies?

For successful expression and purification of recombinant HKU5 M protein, researchers have employed the following optimized methodology:

  • Expression system selection: Bacterial expression systems (particularly E. coli) can be used for cytoplasmic domains, but membrane-spanning regions typically require eukaryotic expression systems such as insect cells or mammalian cells.

  • Construct design: For crystallization studies, researchers typically design constructs that exclude the transmembrane domains while preserving the functional cytoplasmic portion of the M protein.

  • Purification protocol: A multi-step purification process involving:

    • Initial capture using affinity chromatography (Ni-NTA for His-tagged constructs)

    • Ion exchange chromatography for charge-based separation

    • Size exclusion chromatography for final polishing and buffer exchange

  • Protein quality assessment: SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering) analysis to verify monodispersity and proper oligomeric state before crystallization attempts.

Researchers should monitor protein stability throughout the purification process, as membrane proteins often have stability issues when removed from membrane environments .

How does the HKU5 M protein interact with the nucleocapsid (N) protein during viral assembly?

The interaction between HKU5 M protein and N protein is mediated primarily through the carboxy-terminus of the N protein . Computational docking analysis combined with biochemical interaction studies has revealed specific binding interfaces:

  • The C-terminal domain of the N protein contains recognition motifs that interact with specific binding pockets in the cytoplasmic domain of the M protein.

  • This M-N interaction is critical for viral assembly, as it helps coordinate the packaging of the viral genome into newly forming virions.

  • Mutation analysis of key interface residues demonstrates that disrupting these specific interactions can significantly reduce viral assembly efficiency.

A proposed M-N interaction model suggests that the M protein forms a scaffold that captures N protein-RNA complexes, drawing them into position during virion formation. This interaction appears to be conserved across betacoronaviruses, though with sequence-specific adaptations .

What techniques are most effective for studying M protein interactions with other viral components?

For investigating M protein interactions with other viral components, researchers typically employ multiple complementary techniques:

  • Biochemical approaches:

    • Pull-down assays using tagged recombinant proteins

    • Co-immunoprecipitation from infected cells

    • Split-fluorescence systems to detect protein-protein interactions in living cells

  • Structural methods:

    • X-ray crystallography of protein complexes

    • Cryo-electron microscopy for larger assemblies

    • NMR spectroscopy for dynamic interaction analysis

  • Computational approaches:

    • Molecular docking simulations

    • Molecular dynamics to analyze the stability of predicted interfaces

  • Functional validation:

    • Mutagenesis of key residues followed by interaction assays

    • Viral assembly assays with mutant proteins

    • Fluorescence resonance energy transfer (FRET) for real-time interaction studies

These approaches have been successfully used to characterize the interaction between batCOV5-M and the N protein carboxy-terminus, resulting in a computational docking model that provides insights into the mechanism of M protein-mediated protein interactions .

How does HKU5 receptor usage differ from other bat coronaviruses, and what role might the M protein play?

Bat coronavirus HKU5 shows distinct receptor usage patterns compared to related coronaviruses:

  • Primary receptor identification: While early studies suggested HKU5 might use DPP4 (similar to MERS-CoV), recent research has demonstrated that HKU5 actually utilizes ACE2 from Pipistrellus abramus bats as its primary receptor, specifically through its spike protein .

  • Receptor specificity: HKU5 shows a highly restricted ACE2 host range, successfully using only P. abramus, N. vison, and M. erminea ACE2 among numerous tested orthologs . This is in contrast to other ACE2-using coronaviruses like SARS-CoV-2 or merbecoviruses PDF-2180 and NeoCoV that exhibit broader ACE2 usage across mammalian species.

  • M protein contribution: While the spike protein is the primary determinant of receptor specificity, the M protein may contribute to virus assembly efficiency after receptor binding and entry. The M protein's highly conserved structure across coronaviruses suggests its core functions in assembly are preserved, though species-specific adaptations may exist .

  • Structural constraints: The HKU5 spike protein predominantly exists in a closed conformation with all three RBDs in the "down" position, which may hinder interactions with host receptors, potentially delaying host cell entry or facilitating immune evasion .

This receptor specificity information is crucial for understanding HKU5's potential for cross-species transmission and its evolutionary relationship with other coronaviruses.

What experimental models exist for studying HKU5 virus-host interactions and pathogenesis?

Several experimental models have been developed to study HKU5 virus-host interactions:

  • Recombinant virus systems:

    • Synthetic reconstruction of BtCoV HKU5 containing the SARS-CoV spike glycoprotein ectodomain (BtCoV HKU5-SE)

    • Full-length replication-competent molecular clone of HKU5 with green fluorescent protein (GFP) cloned in place of Orf5

  • Animal models:

    • Mouse model for BtCoV HKU5-SE, which replicates efficiently in both young and aged mice

    • BtCoV HKU5-SE targets airway and alveolar epithelial cells in mice

    • Passaged BtCoV HKU5-SE showing enhanced virulence in aged mice, causing 20% weight loss, diffuse alveolar damage, and hyaline membrane formation

  • Cell culture systems:

    • Stable cell lines expressing P. abramus ACE2 (including Vero, 293T, and BHK cells) support efficient viral replication

    • Pseudovirus systems using VSV backbones expressing HKU5 spike protein

    • Tripartite split-fluorescence systems to assess receptor usage and binding

  • Biochemical interaction studies:

    • Bio-layer interferometry (BLI) to quantify receptor binding affinity of different HKU5 variants

    • Flow cytometry-based binding assays with RBD-Fc fusion proteins

These models provide platforms for investigating HKU5 pathogenesis, receptor usage, and potential for cross-species transmission, as well as for testing vaccines and therapeutics .

How do fatty acid binding sites in the HKU5 spike protein influence structure and function, and are similar binding sites present in the M protein?

Recent structural studies have revealed important insights about fatty acid binding in HKU5:

  • Spike protein fatty acid binding:

    • The HKU5 S protein contains two fatty acid binding sites per protomer, identified through cryo-EM studies

    • The first binding site (pocket 1) is located near the interface between the RBDs of adjacent protomers and binds oleic acid

    • The second binding site (pocket 2) is within the RBD near the receptor-binding motif (RBM) and accommodates palmitic acid

    • These fatty acids stabilize the S protein in the closed conformation, potentially regulating receptor binding

  • Structural implications:

    • Pocket 1 is formed by hydrophobic residues F393, L419, L422, L423, F426, V428, F431, P438, L441, L449, V451, V488, A490, F569, and V571 on the RBD

    • The polar head of oleic acid interacts with residues Y463, S468, and A469 from an adjacent protomer

    • This binding appears to stabilize the trimeric assembly in the closed conformation, which may delay host cell entry or facilitate immune evasion

  • M protein binding sites:

    • While fatty acid binding has been well-characterized for the S protein, similar comprehensive studies have not yet been reported for the M protein

    • Given the membrane-associated nature of the M protein, it may interact with membrane lipids, but specific binding pockets analogous to those in the S protein have not been described

  • Methodological considerations:

    • Lipid binding studies for membrane proteins like M typically require different approaches than those used for soluble domains

    • Techniques such as mass spectrometry analysis of protein-lipid complexes or MD simulations may help identify potential lipid-binding regions in the M protein

These findings suggest a potential regulatory role for fatty acids in HKU5 structural dynamics and function, which may extend to other coronaviruses .

What structural adaptations would be necessary for the HKU5 M protein to facilitate human cell infection, and how might these compare to adaptations observed in human-infecting coronaviruses?

While the M protein is not the primary determinant of host range (compared to the spike protein), several structural features of the M protein could contribute to successful human cell infection:

  • M protein interactions with host factors:

    • Adaptations in regions that interact with host cellular machinery might enhance virus assembly efficiency in human cells

    • Modifications to domains that interact with human-specific factors in the secretory pathway could optimize virion production

    • Currently, specific human-adapted features of coronavirus M proteins remain incompletely characterized

  • Comparative analysis with human coronaviruses:

    • The M protein structure of HKU5 shares similarities with those of MERS-CoV, SARS-CoV, and SARS-CoV-2

    • Detailed structural comparison could reveal subtle differences in surface-exposed regions that may interact with host factors

    • Key residues that differ between bat and human coronavirus M proteins might indicate adaptations important for human infection

  • Functional considerations:

    • M protein's role in coordinating assembly of virions may require adaptations to interact optimally with human cellular components

    • Modifications that enhance stability or expression in human cells could contribute to efficient replication

    • Changes that optimize interactions with other viral proteins (particularly the S and N proteins) in the context of human cells could be beneficial

  • Research approaches:

    • Chimeric M proteins containing regions from human coronaviruses could help identify domains important for human adaptation

    • Directed evolution experiments might reveal mutations that enhance M protein function in human cells

    • Structural modeling combined with functional studies could predict potentially adaptive mutations

Current research suggests that while spike protein adaptations are primary drivers of host range expansion, complementary changes in the M protein might enhance replication efficiency in new hosts .

What are the key challenges in developing a recombinant system for studying HKU5 virus replication and assembly?

Developing recombinant systems for studying HKU5 presents several significant challenges:

  • Genomic complexity and size:

    • The large size of coronavirus genomes (~30 kb) makes genetic manipulation technically challenging

    • Stability issues during cloning in bacterial systems may require specialized approaches like bacterial artificial chromosomes (BACs) or in vitro assembly methods

  • Receptor identification and cell tropism:

    • The specific requirement for Pipistrellus abramus ACE2 as receptor necessitates generating stable cell lines expressing this protein

    • Limited tropism may reduce options for experimental systems, as HKU5 shows a highly restricted ACE2 host range

  • Biosafety considerations:

    • Work with full-length, recombinantly derived HKU5 requires Biosafety Level 3 conditions with appropriate personal protective equipment and HEPA-filtered respiratory protection

    • Prior approval from Institutional Biosafety Committees is necessary for such experiments

  • Technical methodologies:

    • Successful approaches include:

      • Genomic cDNA sequences ligated and in vitro transcribed prior to electroporation into cells

      • Generation of chimeric viruses (e.g., BtCoV HKU5-SE with SARS-CoV spike ectodomain) to facilitate cell entry and replication

      • Development of GFP-expressing recombinant viruses for visualization and quantification

  • Validation methods:

    • Confirming authentic viral replication requires multifaceted approaches:

      • Detection of viral proteins through Western blotting

      • Visualization of infected cells (e.g., via GFP fluorescence)

      • Quantification of infectious particles through plaque assays

      • Growth curve analysis to assess replication kinetics

These challenges have been addressed in recent studies through innovative approaches, including generating recombinant viruses with reporter genes and creating stable cell lines expressing the required receptor .

How can researchers optimize protocols for HKU5 M protein expression to ensure proper folding and native conformation?

Optimizing expression of HKU5 M protein presents unique challenges due to its membrane-associated nature. Recommended approaches include:

  • Expression system selection:

    • For full-length M protein: Mammalian or insect cell expression systems (e.g., HEK293, Sf9) that provide appropriate membrane environments and post-translational modifications

    • For cytoplasmic domains: Bacterial systems like E. coli may be sufficient if properly optimized

  • Construct design considerations:

    • Codon optimization for the chosen expression system

    • Addition of purification tags (His, FLAG, etc.) that minimally interfere with structure

    • Strategic placement of tags to avoid disrupting transmembrane regions

    • For structural studies, consider truncated constructs that eliminate transmembrane regions while preserving functional domains

  • Folding optimization strategies:

    • Temperature adjustment during expression (often lower temperatures improve folding)

    • Inducer concentration optimization

    • Addition of molecular chaperones as co-expression partners

    • Use of specialized E. coli strains designed for membrane protein expression

  • Membrane extraction and stabilization:

    • Careful selection of detergents for extraction (e.g., DDM, LMNG)

    • Screening multiple detergent conditions to identify optimal solubilization

    • Consider nanodiscs or amphipols for long-term stability

    • Addition of lipids during purification to maintain native-like environment

  • Quality control methods:

    • Size exclusion chromatography to assess oligomeric state and homogeneity

    • Circular dichroism to evaluate secondary structure content

    • Thermal stability assays to optimize buffer conditions

    • Functional binding assays to confirm proper folding

These methodological considerations are critical for obtaining properly folded M protein that accurately represents its native structure and functional characteristics .

What insights from HKU5 M protein studies can inform development of broadly protective coronavirus vaccines?

Studies of HKU5 M protein provide several valuable insights for vaccine development:

  • Structural conservation across betacoronaviruses:

    • The M protein structure from HKU5 shows significant similarity to M proteins from MERS-CoV, SARS-CoV, and SARS-CoV-2

    • This structural conservation suggests the M protein could serve as a target for broadly protective vaccine approaches

    • Identification of conserved epitopes across multiple coronavirus M proteins could guide design of cross-protective vaccines

  • Reduced eosinophilic immunopathology:

    • Unlike some subgroup 2b SARS-CoV vaccines that elicit strong eosinophilia following challenge, BtCoV HKU5 and MERS-CoV N-expressing Venezuelan equine encephalitis virus replicon particle (VRP) vaccines do not cause extensive eosinophilia following BtCoV HKU5-SE challenge

    • This reduced immunopathology is a crucial consideration for coronavirus vaccine development

  • M protein as complementary vaccine target:

    • While most coronavirus vaccines focus on the spike protein, incorporating M protein elements could potentially enhance protection breadth

    • The high abundance of M protein in virions makes it a substantial antigenic target

    • The more conserved nature of M protein compared to spike could provide more stable antigenic properties

  • Experimental findings relevant to vaccine design:

    • The synthetic reconstruction of BtCoV HKU5 with SARS-CoV spike (BtCoV HKU5-SE) provides a valuable heterologous challenge model for assessing group 2c N protein-based vaccines

    • This model allows for testing whether vaccines targeting conserved proteins like M and N can provide cross-protection

  • Methodological considerations:

    • Expression of properly folded M protein may require specialized approaches due to its membrane association

    • Incorporating M protein into vaccine platforms might require different formulation strategies than soluble proteins

These insights suggest that understanding the M protein structure and immunogenicity could contribute to development of more broadly protective coronavirus vaccines .

What approaches are being used to identify inhibitors targeting the HKU5 proteases or M protein, and how might these compare to existing coronavirus therapeutics?

Research into HKU5-targeted therapeutics has employed several innovative approaches:

These diverse approaches demonstrate the value of HKU5 as a model system for developing broadly active coronavirus therapeutics .

What are the most critical knowledge gaps regarding HKU5 M protein that require further investigation?

Despite recent advances, several critical knowledge gaps regarding HKU5 M protein remain:

Addressing these knowledge gaps would significantly advance our understanding of coronavirus assembly and potentially reveal new targets for antiviral intervention .

How might comparative analyses between HKU5 and emerging coronaviruses inform pandemic preparedness efforts?

Comparative analyses between HKU5 and emerging coronaviruses can provide valuable insights for pandemic preparedness:

  • Receptor adaptation mechanisms:

    • HKU5 primarily uses P. abramus ACE2 but shows divergent binding mechanisms compared to SARS-CoV-2

    • Understanding the molecular determinants of receptor specificity could help predict which bat coronaviruses pose the greatest spillover risk

    • The identification that HKU5 can potentially bind ACE2 orthologs from non-bat species (including some avian species) highlights pathways for potential cross-species transmission

  • Structural adaptations for human infection:

    • Comparing the structures of bat coronavirus proteins with their human-infecting counterparts reveals adaptations that facilitate human cell infection

    • The crystal structure of HKU5 M protein provides a reference point for identifying potential human-adaptive mutations in related viruses

    • Monitoring for these adaptations in surveillance samples could provide early warning of increased human infection risk

  • Cross-protective immunity assessment:

    • Evaluating cross-reactivity between antibodies against human coronaviruses and HKU5 proteins

    • Testing whether vaccines against MERS-CoV or SARS-CoV-2 provide any protection against HKU5 challenge in animal models

    • Research shows that SARS-CoV-2 vaccine sera and the MERS-27 monoclonal antibody did not neutralize VSV-HKU5spike, highlighting antigenic differences that may limit cross-protection

  • Broad-spectrum therapeutic development:

    • Identifying conserved druggable targets across HKU5 and human coronaviruses

    • Designing inhibitors that remain effective against diverse coronavirus lineages

    • Studies have already identified inhibitors active against the nsp5 proteases of subgroup 2c β-CoVs, demonstrating the feasibility of this approach

  • Surveillance strategies:

    • Defining genetic signatures that indicate increased potential for human adaptation

    • Developing molecular assays capable of detecting diverse bat coronaviruses including HKU5

    • Prioritizing surveillance in geographic regions where HKU5 and related viruses circulate

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.