Recombinant Bat coronavirus HKU5 Non-structural protein 3d (3d)

Shipped with Ice Packs
In Stock

Description

Implications for Understanding Coronavirus Evolution

HKU5 has a restricted ACE2 host range, successfully using only P. abramus, N. vison, and M. erminea ACE2 among the 57 orthologs tested . The narrow ACE2 host range of HKU5 is reflected in the distinct molecular interactions with P. abramus ACE2, differing substantially from those of SARS-CoV-2, PDF-2180 . The identification of CoVs in bats revealed that seven intestinal samples were positive for coronaviruses . Sequencing of the amplification products revealed that these seven sequences belonged to two lineages .

Tables

Because information is limited, the following tables provide general information regarding the context of "Recombinant Bat coronavirus HKU5 Non-structural protein 3d (3d)" based on available information.

Table 1: Sequence Identity of Replicase Domains in Bat CoV CD35 Compared to Other Coronaviruses

RegionBat Hp-betaCoV Zhejiang2013SARS-CoV-2SARS-CoV-1SARSr-CoV-1 (HKU3)SARSr-CoV-2 (GX-P5L, RaTG13, and RmYN02)
3CLpro68.3%
RdRp77.0%
Hel81.0%

Table 2: ACE2 Usage by Different Coronaviruses

CoronavirusACE2 Usage
HKU5P. abramus, N. vison, and M. erminea ACE2
SARS-CoV-2Broader ACE2 usage across mammalian species
PDF-2180Broader ACE2 usage across mammalian species

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. To request a specific tag type, please inform us, and we will prioritize its development.
Synonyms
3d; Non-structural protein 3d; ns3d; Accessory protein 3d
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-223
Protein Length
full length protein
Species
Bat coronavirus HKU5 (BtCoV) (BtCoV/HKU5/2004)
Target Names
3d
Target Protein Sequence
MAFSPSLFQPLVIQKETHGGEPSSPNHVIACIPLTGYVAALVVNACFYPLLFCLPYSSCR ASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCIILMAIWTIDRVRFCLLIRSL RPLIDMRSNFIRVNTVAGGVVIPVNYSKPWFVKNFNQRCRCTNCFFAHSATYLECTFISR FSKTTLVSISDFQLNGSHSTVFVPFNSRDSVPLHIIAPSVLTV
Uniprot No.

Target Background

Database Links

KEGG: vg:4836007

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

How does HKU5's receptor binding compare to other betacoronaviruses, and what implications does this have for researchers studying non-structural proteins?

HKU5 exhibits a unique receptor specificity pattern that differs significantly from related betacoronaviruses. Recent research has demonstrated that HKU5 specifically utilizes ACE2 from Pipistrellus abramus (P.abr) bats as its entry receptor, with a binding affinity (Kd) of approximately 19.94 ± 0.23 nM . This receptor specificity differs from MERS-CoV, which uses DPP4 (dipeptidyl peptidase 4).

The receptor binding domain (RBD) of HKU5 forms a compact four-stranded antiparallel β-sheet with short α-helices on both sides, creating a receptor-binding motif (RBM) that interacts with P.abr ACE2 through these key residues:

  • HKU5 RBM: D460, M461, Y464, E472, I473, Y508, T510, E511, Y513, T515, S516, A517, Y518, G519, K520, Y522, K544, Y545, Q546, S547, G551, T556, Y558, Y560

  • P.abr ACE2: R26, L29, V30, N33, H34, E37, N38, H41, D90, I92, I93, Q96, M322, T323, P324, G325, W327, R328, D329, K352, N353, D354, R356, A385, N386, Q387, S388, R392

For researchers studying non-structural proteins like 3d, this receptor specificity provides important contextual information about viral evolution and host adaptation, potentially informing how accessory proteins may co-evolve with structural proteins to optimize replication in specific host species.

What experimental approaches should be used to investigate potential interactions between HKU5-3d and host immunity?

When investigating potential interactions between HKU5-3d and host immunity, researchers should implement a multi-faceted experimental approach:

  • Co-immunoprecipitation assays: To identify direct protein-protein interactions between HKU5-3d and host immune factors

  • RNA-seq analysis: Compare transcriptomes of cells expressing HKU5-3d versus control cells to identify differentially expressed immune genes

  • Reporter assays: Utilize luciferase reporters driven by immune-responsive promoters (e.g., IFN-β, NF-κB) to assess whether HKU5-3d suppresses or enhances immune signaling

  • CRISPR screens: To identify host factors that, when knocked out, alter the function of HKU5-3d

  • Structural biology approaches: X-ray crystallography or cryo-EM studies to determine how HKU5-3d might interact with host factors

For valid comparisons, researchers should consider including other coronavirus accessory proteins with known immune evasion functions as positive controls. While HKU5-3d is less characterized than the HKU5 spike protein, methodological rigor in these approaches can help elucidate its potential role in modulating host immunity, which may be relevant to the virus's ability to persist in bat populations.

How can researchers optimize expression and purification of soluble, correctly folded recombinant HKU5-3d protein?

Optimizing expression and purification of soluble, correctly folded recombinant HKU5-3d protein requires addressing several technical challenges:

  • Expression system selection:

    • E. coli: Use BL21(DE3) or Rosetta strains with tightly controlled inducible promoters

    • Insect cells: Consider Sf9 or Hi5 cells with baculovirus expression systems for enhanced folding

    • Mammalian cells: HEK293T or ExpiCHO systems for native-like post-translational modifications

  • Fusion tag strategies:

    • N-terminal tags (His6, GST, MBP) can improve solubility

    • Consider SUMO or thioredoxin tags for difficult-to-express proteins

    • Include a TEV or PreScission protease cleavage site for tag removal

  • Buffer optimization:

    • Initial screening with various pH conditions (6.5-8.5)

    • Test different salt concentrations (150-500 mM NaCl)

    • Include glycerol (5-15%) to improve stability

    • For HKU5-3d specifically, Tris-based buffer with 50% glycerol has been reported as optimal

  • Purification strategy:

    • Initial capture: IMAC (for His-tagged proteins)

    • Intermediate: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

    • Quality control: SDS-PAGE, Western blot, mass spectrometry

  • Storage conditions:

    • Store at -20°C or -80°C for extended periods

    • Avoid repeated freeze-thaw cycles

    • For working aliquots, store at 4°C for up to one week

For HKU5-3d specifically, expression regions including the full-length protein (amino acids 1-223) have been reported, which should guide construct design .

What are the key structural differences between HKU5 and related betacoronaviruses that might influence functional studies of non-structural proteins?

Structural analysis of HKU5 reveals several distinct features compared to related betacoronaviruses that could impact functional studies of non-structural proteins:

  • Spike protein conformation:

    • HKU5 S protein exhibits a closed conformation with all three receptor-binding domains (RBDs) in the "down" position

    • This differs from the open conformations observed in SARS-CoV-2, MERS-CoV, and HKU1-B

    • The closed conformation may hinder receptor interactions, potentially delaying host cell entry

  • Unique ligand binding pockets:

    • Two non-protein densities identified in the HKU5 S protein:

      • Pocket 1: Located near the interface between adjacent RBDs, containing oleic acid

      • Pocket 2: Located within the RBD near the receptor-binding motif (RBM), containing palmitic acid

    • These fatty acid binding sites may influence protein stability and function

  • Receptor binding interface:

    • HKU5 utilizes a distinct binding mode with P.abr ACE2 compared to other coronaviruses

    • The HKU5 RBD buries a surface area of ~950 Ų when binding to P.abr ACE2

    • Key interaction includes the P.abr ACE2 α-helix 323-330 docking against the HKU5 RBM

  • C-terminal domain (CTD) structure:

    • HKU5-CTD contains two discrete subdomains: core and external

    • HKU5-CTD exhibits a six-residue deletion in β3′ which causes large structural differences compared to MERS-RBD/CTD and HKU4-RBD/CTD

    • This structural shift in the CD26-interaction interface results in HKU5's inability to bind this receptor

What methodologies should be employed to investigate the potential role of HKU5-3d in cross-species transmission?

Investigating the potential role of HKU5-3d in cross-species transmission requires a comprehensive methodological approach:

  • Sequence analysis and evolutionary studies:

    • Conduct comparative genomics across HKU5 lineages to identify conserved and variable regions in 3d

    • Analyze selection pressure using dN/dS ratios to identify positively selected sites

    • Compare 3d sequences across various bat coronavirus strains to identify host-specific adaptations

  • Receptor interaction studies:

    • Examine whether 3d influences the interaction between spike protein and ACE2

    • Investigate if 3d alters viral entry efficiency in cells expressing ACE2 from different species

    • HKU5 shows varying affinities for ACE2 from different species:

      • P.abramus ACE2: Kd = 19.94 ± 0.23 nM

      • Pitta sordida ACE2: Kd = 122.9 ± 1.3 nM

  • Cell culture adaptation experiments:

    • Passage HKU5 in cells from different species to identify adaptive mutations in 3d

    • Monitor changes in viral replication efficiency and cytopathic effects

    • Previous passage experiments with HKU5-SE in mice resulted in enhanced virulence with mutations in several genes

  • Host-specific protein interaction screening:

    • Use proteomics approaches to identify species-specific interaction partners of 3d

    • Employ split-reporter assays (similar to the tripartite split-fluorescence system used for spike-ACE2 interaction studies )

  • Animal model studies:

    • Develop transgenic mice expressing bat ACE2 receptors to study HKU5 infection

    • Compare infection dynamics in various animal models expressing different ACE2 orthologues

    • Previous studies have shown that synthetic reconstruction of BtCoV HKU5 containing the SARS-CoV spike glycoprotein ectodomain (BtCoV HKU5-SE) replicates efficiently in young and aged mice

These methodologies should be integrated to comprehensively evaluate how HKU5-3d might contribute to the virus's potential for cross-species transmission.

How do structural variations in the HKU5 RBD across different viral lineages affect receptor binding, and what insights does this provide for studying accessory proteins?

Structural variations in the HKU5 RBD across different viral lineages significantly impact receptor binding affinity and specificity, providing important contextual information for studies of accessory proteins like 3d:

RBD Variation and Binding Affinity

Different HKU5 lineages exhibit varying affinities for P.abramus ACE2 (PaPD):

HKU5 LineageBinding Affinity (Kd) to PaPD
HKU5 (reference)19.94 ± 0.23 nM
BtPa-BetaCoV/GD201323.40 ± 0.27 nM
BatCoV-HKU5-325.17 ± 0.29 nM
BatCoV-HKU5-related35.24 ± 0.37 nM

These variations suggest that mutations in different HKU5 strains may facilitate adaptation to ACE2 receptors from different species .

Key Residues in RBD-Receptor Interaction

Mutation studies have identified critical residues in the HKU5 RBD that affect binding:

  • Conserved critical residues: Y463, Y507, Y517, K519, Y521, K543, S546, Y557, Y559

    • K519A mutation reduces receptor binding by >50%

  • Non-conserved residues: Y507, K543, Y544, Y557

    • Mutations Y507H, K543D, and Y557S reduce binding by ~50%

Cross-Species Potential

The sequence and structural variations also impact binding to ACE2 from non-host species:

RBD VariantBinding Affinity (Kd) to PsPD (Pitta sordida ACE2)
HKU5122.9 ± 1.3 nM
BtPa-BetaCoV/GD2013137.8 ± 0.9 nM
HKU5-3176.2 ± 1.4 nM
HKU5-related232.5 ± 2.0 nM

Insights for Accessory Protein Studies

These findings provide crucial context for studying accessory proteins like 3d:

  • Evolutionary pressure on spike proteins likely influences accessory protein adaptation

  • Lineage-specific variations in 3d may correlate with RBD changes

  • Cross-species transmission potential indicated by RBD binding studies should guide host selection for 3d functional studies

  • The specificity of HKU5 for P.abramus ACE2 suggests that studies of 3d should prioritize this host cellular context

Researchers studying 3d should consider these spike protein variations as potential indicators of broader viral adaptation strategies that might involve coordinated changes across multiple viral proteins.

What are the challenges and methodologies for developing inhibitors targeting HKU5 proteins including non-structural protein 3d?

Developing inhibitors targeting HKU5 proteins, including non-structural protein 3d, presents several unique challenges that require sophisticated methodological approaches:

Challenges

  • Limited structural information: Unlike the spike protein, detailed structural information for HKU5-3d is not readily available

  • Protein expression difficulties: Membrane-associated or hydrophobic viral proteins can be challenging to express in soluble form

  • Assay development: Functional assays for 3d would need to be developed first to screen potential inhibitors

  • Specificity concerns: Inhibitors must be specific to viral proteins without affecting host homologs

  • Cross-reactivity potential: Determining whether inhibitors targeting HKU5-3d would be effective against related coronaviruses

Methodological Approaches

  • Structure-based drug design:

    • Homology modeling of HKU5-3d based on related coronavirus proteins

    • Molecular docking studies with virtual compound libraries

    • Fragment-based screening to identify binding pockets

  • High-throughput screening:

    • Development of biochemical assays specific to 3d function

    • Cell-based reporter assays to measure inhibition of 3d activity

    • Previous studies have identified inhibitors against the nsp5 proteases of subgroup 2c β-CoVs

  • Peptide-based inhibitors:

    • Design of peptides that mimic interaction interfaces of 3d with host factors

    • Optimization through stapling or other stabilization methods

  • Antibody-based approaches:

    • Development of neutralizing antibodies against 3d

    • Intrabodies that can target intracellular 3d

  • Validation in relevant models:

    • Testing in cell culture systems expressing P.abramus ACE2

    • Potential use of the BtCoV HKU5-SE mouse model, which has been shown to replicate efficiently in cell culture and in young and aged mice

  • Comparative effectiveness:

    • Testing inhibitor efficacy against different HKU5 lineages

    • Cross-testing against other betacoronaviruses to identify broad-spectrum potential

This multifaceted approach acknowledges the challenges specific to targeting accessory proteins while leveraging available information about HKU5 biology to guide inhibitor development.

How do variations in ACE2 receptors across different species affect HKU5 binding, and what experimental approaches should be used to study these interactions?

Variations in ACE2 receptors across different species significantly impact HKU5 binding, with important implications for viral host range and transmission potential. Understanding these interactions requires sophisticated experimental approaches:

Species-Specific ACE2 Variations and Binding

HKU5 demonstrates clear preference for ACE2 from its natural host, Pipistrellus abramus bats, with limited or no binding to ACE2 from other species . Key findings include:

  • Critical binding motifs in P.abramus ACE2:

    • Two consecutive three-residue motifs: 327WRD329 and 352KND354

    • Point mutations in these motifs significantly reduce binding

    • R328 forms a critical salt bridge with D459 in HKU5 RBD

  • ACE2 from other Pipistrellus species:

    • HKU5 cannot use ACE2 from P.pipistrellus or P.khuli

    • Variations at residues 328 and 329 likely explain this specificity

    • N329 in P.pipistrellus ACE2 is N-glycosylated, while the corresponding R328 in P.abramus ACE2 is not

  • Cross-species binding potential:

    • Pitta sordida (bird) ACE2 can bind HKU5 RBD with reduced affinity (Kd = 122.9 ± 1.3 nM)

    • Sequence identity of P.sordida ACE2 peptidase domain: 69% with P.abramus and 76% with human

Experimental Approaches

  • Binding affinity measurements:

    • Bio-layer interferometry (BLI) to quantify binding affinities between RBDs and ACE2 variants

    • Surface plasmon resonance (SPR) for real-time binding kinetics

  • Structural analysis:

    • Cryo-EM structures of HKU5 RBD in complex with ACE2 from different species

    • X-ray crystallography of binding interfaces

    • Comparative analysis of binding modes (e.g., the HKU5 RBD–P.sordida ACE2 complex structure revealed conformational shifts compared to P.abramus ACE2)

  • Cell-based entry assays:

    • Pseudotyped virus entry assays using cells expressing ACE2 from different species

    • Stable cell lines transduced with P.abramus ACE2 show high susceptibility to HKU5

    • Live virus assays to validate pseudotyped virus findings

  • Interaction visualization techniques:

    • Tripartite split-fluorescence system with flow cytometry to identify key residues

    • This system showed high sensitivity for HKU5 RBD interaction with P.abramus ACE2, with signal intensity exceeding that with human ACE2 by more than tenfold

  • Mutagenesis studies:

    • Targeted mutations of interface residues to assess their contribution to binding

    • Mutations of non-conserved residues to their corresponding residues in other lineages

These approaches provide a comprehensive framework for studying HKU5-ACE2 interactions across species, which is essential for understanding the virus's host range and potential for cross-species transmission.

What challenges exist in developing a reverse genetics system for HKU5, and how might this system be used to study the function of non-structural protein 3d?

Developing a reverse genetics system for HKU5 presents several specific challenges but would provide invaluable tools for studying non-structural protein 3d:

Challenges in HKU5 Reverse Genetics System Development

  • Genome size and stability:

    • The large genome size of coronaviruses (~30kb) makes cloning and manipulation technically challenging

    • Instability of viral sequences in bacterial systems may require alternative cloning strategies

  • Cell culture adaptation:

    • HKU5 has historically been difficult to cultivate in cell culture

    • Previous studies noted that HKU5 "has been described in silico but has not been shown to replicate in culture"

    • This necessitates receptor identification and expression in target cells

  • Receptor specificity:

    • HKU5's strict preference for P.abramus ACE2 limits usable cell lines

    • Cells must be engineered to express this receptor for productive infection

  • BSL containment considerations:

    • Potential for adaptation to human cells raises biosafety concerns

    • Previous passage experiments showed enhanced virulence in mice after adaptation

Methodological Approaches for System Development

  • Synthetic reconstruction:

    • Similar to previous work where researchers reported "synthetic reconstruction and testing of BtCoV HKU5 containing the SARS-CoV spike glycoprotein ectodomain (BtCoV HKU5-SE)"

    • This chimeric approach allowed the virus to replicate in standard cell lines

  • Bacterial artificial chromosome (BAC) system:

    • Clone full-length viral genome into BAC for stability

    • Include T7 promoter for in vitro transcription

  • Yeast-based systems:

    • Transform fragments into yeast for assembly via homologous recombination

    • Extract assembled genomes for transcription and transfection

  • Receptor engineering:

    • Generate stable cell lines expressing P.abramus ACE2

    • VeroE6 cells transduced with P.abramus ACE2 have been shown to be highly susceptible to HKU5

Applications for Studying Non-structural Protein 3d

  • Knockout studies:

    • Generate 3d deletion mutants to assess its role in viral replication

    • Compare growth kinetics between wild-type and Δ3d viruses

  • Reporter gene insertion:

    • Replace 3d with fluorescent proteins to visualize infection

    • Use luciferase reporters for quantitative measurements

  • Protein tagging:

    • Insert epitope tags to facilitate protein localization and interaction studies

    • Implement split reporter systems for protein-protein interaction analysis

  • Point mutation analysis:

    • Introduce specific mutations to identify functional domains

    • Assess the impact of naturally occurring variations across HKU5 lineages

  • Cross-species adaptation studies:

    • Passage the reverse genetics-derived virus in cells expressing ACE2 from different species

    • Monitor for adaptive mutations in 3d that correlate with expanded host range

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.