Recombinant Bat coronavirus HKU9 Membrane protein (M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Bat coronavirus HKU9 (BtCoV) (BtCoV/HKU9)
Target Names
M
Target Protein Sequence
MSNNCTNTVPRPEVIAALKDWNFAVSVILLFITVLLQWGYPSRCKPIWVIKMFILWLLWP LSIAAAVFAAIHPINSVAFGFAIAFACISGIMWLSYFISSFRLLCRTGSAWSFMPETDML INIPLLGRTVTRPIISDSPAVQFLIIRGELRFDGFTLGRCDPGDMPDIVTIARPNALHWY KRALTRNMYTRSAILVYIKYKVGNHRVQNTTEDGDRLAMFVA
Uniprot No.

Target Background

Function
A viral envelope component crucial for virus morphogenesis and assembly through interactions with other viral proteins.
Database Links

KEGG: vg:4836016

Protein Families
Betacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Bat coronavirus HKU9 Membrane protein?

The Bat coronavirus HKU9 Membrane (M) protein is a key structural component that plays essential roles in viral assembly and budding. While specific structural data on HKU9 M protein is limited, it likely shares fundamental characteristics with other betacoronavirus M proteins. The coronavirus M protein typically contains three transmembrane domains with a small external N-terminal ectodomain and a large C-terminal endodomain that extends into the viral interior . Research indicates that the core subdomain fold in HKU9 proteins resembles those observed in other betacoronaviruses, suggesting conserved structural elements across this genus .

When expressing recombinant HKU9 M protein for structural studies, researchers should consider using similar construct designs that have been successful with other coronavirus M proteins, including the incorporation of appropriate signal peptides and purification tags. For example, the use of N-terminal gp67 signal peptide and C-terminal hexahistidine tags has been effective for related HKU9 protein expression .

How does the Bat coronavirus HKU9 M protein compare to other betacoronavirus M proteins?

The Bat coronavirus HKU9 is phylogenetically affiliated with the same genus as MERS-CoV, placing it within the betacoronavirus family . Comparative analysis of available betacoronavirus structures reveals that while specific protein domains may exhibit unique features, core structural elements tend to be conserved.

In HKU9 proteins, the core subdomain folds typically resemble those of other betacoronaviruses, while external subdomains may display unique characteristics . For instance, the receptor binding domain (RBD) of HKU9 contains a core subdomain similar to other betaCoVs but possesses a distinctive external subdomain with a single helix structure rather than the beta-sheet topology observed in other betaCoVs . This pattern may extend to the M protein, suggesting potentially unique external-facing regions while maintaining conserved core structural elements.

What expression systems are most effective for recombinant production of HKU9 M protein?

For recombinant expression of Bat coronavirus HKU9 proteins, the Bac-to-Bac baculovirus expression system has proven effective in previous studies . This system offers advantages for membrane protein expression including:

  • Post-translational modification capabilities

  • Ability to handle complex transmembrane proteins

  • Higher yields compared to bacterial systems for membrane proteins

The methodology typically involves:

  • Insertion of the target gene into a modified pFastBac1 vector

  • Incorporation of an N-terminal gp67 signal peptide to facilitate secretion

  • Addition of a C-terminal hexahistidine tag for purification purposes

  • Transfection into Sf9 insect cells for protein expression

For functional studies requiring mammalian post-translational modifications, researchers have successfully used the pCAGGS vector system with fusion to mouse IgG Fc fragment (mFc) in 293T cells .

What methodological approaches can resolve contradictory findings regarding HKU9 M protein interactions with host cell proteins?

When encountering contradictory results regarding HKU9 M protein interactions, a multi-faceted approach combining different biochemical and biophysical techniques is recommended. Based on successful protocols used for other HKU9 proteins, researchers should:

  • Employ surface plasmon resonance (SPR) with both immobilized and captured protein configurations to validate interactions. This dual approach can eliminate false negatives resulting from improper protein orientation or missing post-translational modifications .

  • Complement SPR data with solution-based interaction studies such as isothermal titration calorimetry (ITC) or microscale thermophoresis (MST).

  • Validate protein functionality through cell-based assays before interaction studies.

  • Consider testing recombinant proteins expressed in different systems (bacterial, insect, and mammalian) to account for post-translational modification effects.

For example, when studying HKU9 RBD interactions, researchers used both direct immobilization and captured SPR methods to conclusively demonstrate that HKU9-RBD does not bind to either ACE2 or CD26 receptors .

How can researchers effectively analyze the membrane topology and post-translational modifications of recombinant HKU9 M protein?

Analysis of membrane topology and post-translational modifications requires a comprehensive approach:

Membrane Topology Analysis:

  • Prediction software coupled with experimental validation

  • Protease protection assays with domain-specific antibodies

  • Glycosylation site mapping using endoglycosidases

  • Cysteine accessibility methods for transmembrane domain mapping

Post-translational Modification Analysis:

When expressing recombinant HKU9 proteins, researchers should consider using mammalian expression systems for studies requiring authentic mammalian post-translational modifications, as demonstrated in previous HKU9 protein studies where both insect cell and mammalian cell expression systems were used to validate protein functionality .

What structural and functional assays can determine if the HKU9 M protein contains conserved intersubdomain binding modes similar to those identified in HKU9 RBD?

To investigate whether HKU9 M protein exhibits conserved intersubdomain binding modes similar to those observed in HKU9 RBD, researchers should employ complementary structural and functional approaches:

Structural Approaches:

  • X-ray crystallography for high-resolution structural determination, following protocols similar to those used for HKU9-RBD crystallization

  • Solution NMR for dynamic structural information, as applied to HKU9 SARS-unique region proteins

  • Cryo-EM for visualization of intact membrane protein in near-native states

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify interacting regions

Functional Approaches:

  • Site-directed mutagenesis targeting predicted interaction interfaces

  • Truncation constructs to isolate potential subdomains

  • Cross-linking coupled with mass spectrometry (XL-MS) to identify spatial proximity

  • FRET-based assays to detect conformational changes upon binding events

This multi-technique approach would help establish whether the M protein follows similar structural principles to the RBD, where specific intersubdomain interactions anchor the external subdomain to the core subdomain .

What purification strategy optimizes yield and purity of recombinant HKU9 M protein while maintaining its native conformation?

The optimal purification strategy for recombinant HKU9 M protein should balance yield, purity, and structural integrity. Based on successful approaches with other HKU9 proteins, the following protocol is recommended:

Purification Protocol:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using the C-terminal hexahistidine tag

    • Buffer composition: 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.5% suitable detergent (for membrane proteins)

    • Elution with imidazole gradient (20-500 mM)

  • Intermediate Purification: Size exclusion chromatography

    • Buffer compatibility with downstream applications

    • Assessment of oligomeric state and aggregation

  • Final Polishing: Ion exchange chromatography if necessary

For transmembrane proteins like HKU9 M, detergent selection is critical:

  • Initial screening should include mild detergents (DDM, LMNG, GDN)

  • Stability assessment using differential scanning fluorimetry

  • Consider amphipol or nanodisc reconstitution for functional studies

Typical yields from insect cell expression systems for coronavirus structural proteins range from 1-5 mg/L culture, with final purity >95% as assessed by SDS-PAGE and SEC-MALS analysis.

How can researchers design robust binding assays to identify potential receptors or interaction partners for HKU9 M protein?

Designing robust binding assays for HKU9 M protein interaction studies requires a systematic approach:

Binding Assay Development Strategy:

  • Protein Preparation:

    • Express protein with different tags (His, GST, mFc) to enable multiple assay formats

    • Validate protein functionality before binding studies

    • Consider both detergent-solubilized and membrane-reconstituted formats

  • Primary Screening Methods:

    • Surface plasmon resonance (SPR) with captured protein orientation

    • Bio-layer interferometry (BLI) for kinetic analysis

    • Protein microarrays for wide-scale screening

  • Validation Methods:

    • Co-immunoprecipitation with candidate partners

    • Proximity labeling in cellular contexts (BioID, APEX)

    • FRET/BRET assays for live-cell interaction monitoring

  • Controls and Validation:

    • Include positive controls (known coronavirus M protein interactions)

    • Validate with multiple methods to eliminate technique-specific artifacts

    • Test both mammalian and insect cell-expressed proteins to account for post-translational modifications

This approach mirrors successful strategies used for HKU9 RBD, where SPR conducted under various conditions conclusively determined receptor binding properties .

What crystallization and structural determination approaches are most suitable for obtaining high-resolution structures of HKU9 M protein?

Obtaining high-resolution structures of membrane proteins like HKU9 M presents significant challenges that require specialized approaches:

Crystallization Strategy:

  • Construct Optimization:

    • Design multiple constructs with varying N/C-terminal boundaries

    • Consider fusion proteins (T4 lysozyme, BRIL) to enhance crystallization

    • Remove flexible regions based on disorder prediction

  • Crystallization Screening:

    • Lipidic cubic phase (LCP) for transmembrane regions

    • Vapor diffusion with detergent-solubilized protein

    • In successful HKU9 protein crystallization, conditions like 0.1 M sodium citrate tribasic dihydrate (pH 7.0) and 12% PEG 20000 yielded diffractive crystals

  • Crystal Optimization:

    • Additive screening to improve crystal quality

    • Dehydration protocols to tighten crystal packing

    • Heavy atom derivatives for phasing, as demonstrated with Au derivatives for HKU9 proteins

Data Collection and Structure Determination:

ApproachResolution PotentialAdvantagesChallenges
X-ray Crystallography1.5-3.0 ÅHighest resolution, detailed side chain informationDifficult crystallization, phase determination
Cryo-EM2.5-4.0 ÅNo crystallization needed, near-native stateSample preparation, data processing complexity
NMRStructure of domains (10-25 kDa)Dynamic information, solution stateSize limitations, requirement for isotope labeling

Based on previous successes with HKU9 proteins, X-ray crystallography with heavy atom phasing has proven effective, with achievable resolutions around 2.1 Å for well-diffracting crystals .

How does the HKU9 M protein interact with other viral structural proteins during virion assembly?

The coronavirus M protein plays a central role in virion assembly through interactions with other structural proteins. For HKU9 M protein, these interactions likely follow patterns observed in other betacoronaviruses but may contain unique features:

Methodological Approach to Study Assembly Interactions:

  • Co-expression Systems:

    • Multi-protein expression using baculovirus expression systems

    • Split-reporter assays (BiFC, split luciferase) to visualize interactions

    • Co-immunoprecipitation with differentially tagged proteins

  • Binding Interface Mapping:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Cross-linking mass spectrometry (XL-MS)

    • Truncation mutants to identify minimal interaction domains

  • Visualization Techniques:

    • Negative stain electron microscopy of reconstituted complexes

    • Cryo-electron tomography of virus-like particles

    • Super-resolution microscopy for cellular localization

When designing these experiments, researchers should consider the homologous intersubdomain binding modes observed in HKU9 RBD that anchor subdomains together . Similar principles may govern M protein interactions with other viral components.

What experimental approaches can determine the host range restrictions imposed by HKU9 M protein?

Understanding host range restrictions requires a systematic approach examining M protein interactions with host cell machinery:

Experimental Strategy:

  • Cell Line Susceptibility Testing:

    • Expression of HKU9 M protein in cell lines from different species

    • Assessment of cellular localization and trafficking

    • Identification of species-specific differences in post-translational modifications

  • Chimeric Protein Analysis:

    • Construction of chimeric M proteins between HKU9 and other coronaviruses

    • Domain swapping to identify regions responsible for host specificity

    • Tracking of chimeric protein localization and interaction patterns

  • Interactome Analysis:

    • Proximity labeling (BioID, APEX) to identify host interaction partners

    • Comparative interactomics across cell lines from different host species

    • Validation of key interactions through direct binding assays

  • Functional Assays:

    • Virus-like particle formation efficiency in different cell types

    • Membrane fusion assays with cells from different species

    • Cell-cell fusion assays mediated by viral proteins

This approach is particularly important given that HKU9 has been demonstrated to have unique receptor binding properties, suggesting species-specific adaptations in its structural proteins .

How has the HKU9 M protein evolved compared to other bat coronaviruses, and what does this reveal about its potential for cross-species transmission?

Evolutionary analysis of the HKU9 M protein provides critical insights into its adaptation and potential for cross-species transmission:

Methodological Framework:

  • Sequence-Based Analysis:

    • Multiple sequence alignment of coronavirus M proteins

    • Phylogenetic tree construction using maximum likelihood methods

    • Selection pressure analysis (dN/dS ratios) to identify sites under positive selection

  • Structural Comparison:

    • Homology modeling based on available coronavirus M protein structures

    • Mapping of conserved versus variable regions onto structural models

    • Identification of structural adaptations specific to bat hosts

  • Functional Conservation Testing:

    • Complementation assays with M proteins from different coronaviruses

    • Assessment of interaction conservation with other viral proteins

    • Evaluation of host protein interaction conservation across species

This evolutionary analysis should consider findings that while HKU9 shares phylogenetic affiliation with other betacoronaviruses like MERS-CoV, it possesses unique structural features that affect its binding properties . These unique features may represent adaptations to specific bat host receptors and cellular machinery, with implications for potential cross-species transmission barriers.

What structural and functional differences exist between recombinant and native forms of HKU9 M protein?

Comparative Analysis Approach:

  • Post-translational Modification Comparison:

    • Mass spectrometry-based PTM mapping of both recombinant and native proteins

    • Glycosylation pattern analysis using glycosidases and lectin binding

    • Phosphorylation state comparison using phospho-specific antibodies

  • Structural Integrity Assessment:

    • Circular dichroism spectroscopy for secondary structure comparison

    • Limited proteolysis to assess domain folding and accessibility

    • Thermal stability comparison using differential scanning fluorimetry

  • Functional Equivalence Testing:

    • Binding assays with known interaction partners

    • Membrane association characteristics

    • Oligomerization state analysis

When designing recombinant expression systems, researchers should consider that both insect cell and mammalian expression systems have been used successfully for HKU9 proteins, with mammalian systems potentially providing more authentic post-translational modifications for functional studies .

This type of analysis is particularly important given observations that post-translational modifications can affect the functionality of coronavirus proteins, as demonstrated in the case of HKU9 RBD binding studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.