Recombinant Bat coronavirus HKU9 Non-structural protein 3 (3)

Shipped with Ice Packs
In Stock

Description

Functional Roles

The native HKU9 nsp3 performs multiple functions, which are preserved in its recombinant form:

RoleMechanismSource
Polyprotein CleavageAssists viral proteases in cleaving the replicase polyprotein (ORF1a/b)
Immune InterferenceInhibits host antiviral pathways (e.g., NF-κB signaling) to evade detection
Genome ReplicationPotential involvement in viral RNA synthesis or transcription regulation

A conserved functional site in the SARS-unique region may mediate RNA binding or protein interactions critical for viral replication .

Conservation and Evolution

The SARS-unique region, once thought exclusive to SARS-CoV, is conserved in HKU9 and other betacoronaviruses, highlighting its evolutionary significance . Key insights include:

  • Sequence Similarity: HKU9 nsp3 shares structural homology with SARS-CoV nsp3 but lacks functional overlap with other bat coronavirus spike proteins (e.g., HKU9-RBD does not bind ACE2/CD26) .

  • Zoonotic Potential: Structural studies suggest HKU9 nsp3 may facilitate host adaptation, though direct transmission to humans is unconfirmed .

Research Applications and Production

The recombinant HKU9 nsp3 is synthesized via codon-optimized gene expression in E. coli or mammalian systems, enabling structural and functional studies . Applications include:

ApplicationMethodSource
Structural BiologyNMR and crystallography to map conserved domains and functional sites
Immune StudiesEpitope mapping for vaccine development
Drug TargetingScreening inhibitors against conserved functional sites

Production Details:

ParameterDetailSource
ConstructResidues 573–646 of mature nsp3 with N-terminal Ser-His-Met tag
Expression HostE. coli (for structural studies) or mammalian cells (for post-translational modifications)

Key Research Findings

  • Structural Diversity: The frataxin fold in HKU9 nsp3 differs from other betacoronaviruses, suggesting unique functional adaptations .

  • Conserved Functional Site: Biochemical assays identified a conserved site in HKU9 and SARS-CoV nsp3, potentially critical for RNA binding .

  • Immune Evasion: HKU9 nsp3 may inhibit host immune responses via mechanisms distinct from other coronaviruses .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
3; Non-structural protein 3; ns3; Accessory protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-220
Protein Length
full length protein
Species
Bat coronavirus HKU9 (BtCoV) (BtCoV/HKU9)
Target Names
3
Target Protein Sequence
MNLYNLVRDALRPSYATVSPSVDEPTVDNNFVALSCYATLSVLLYYLQRVKQPYLSMLFH ILFCLSQVCMVIWLIFSANFYVSLFAQCMLVVCALGCFLERTILSIKLRSMAPFMSMADN FAIIKTTCNNYVFPVERSSDNLVVLTTSRGIYSNGVFMKGAITVSDNALVVSLFKSHSLL LDRVEHGYDYTVFIYINSVILQNIKPTVSVVNTEFTDVEL
Uniprot No.

Target Background

Database Links

KEGG: vg:4836013

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structural characterization of the non-structural protein 3 (nsp3) in Bat coronavirus HKU9?

The nsp3 of Bat coronavirus HKU9 (Ro-BatCoV HKU9) is a multifunctional protein comprising multiple structural domains. Solution NMR studies have revealed that the C-terminal domain of the "SARS-unique region" of HKU9 nsp3 contains a frataxin fold or double-wing motif, which is an α + β fold associated with protein-protein interactions, DNA binding, and metal ion binding . This domain spans residues 573-646 of nsp3, corresponding to residues 1345-1418 of the replicase polyprotein 1ab . The structure determination was carried out using multidimensional NMR experiments with 96% of observable resonances assigned . High structural similarity to the human SARS coronavirus nsp3 is evident, suggesting conserved functions across different coronavirus lineages .

Methodology for structure determination:

  • Expression of the construct in E. coli with complete domain spanning residues 573-646

  • Multidimensional NMR experiments for resonance assignment

  • 3D 15N- and 13C-resolved [1H,1H] NOESY experiments for structure determination

  • What is the significance of the "SARS-unique region" in nsp3 of HKU9?

Despite its name, the "SARS-unique region" is not exclusive to SARS-CoV but is conserved among several phylogenetic groups of coronaviruses, including group B, C, and D betacoronaviruses . The structural characterization of this region in HKU9 provides strong experimental support for this conservation. In SARS-CoV, functions of this region are essential for viral replication . The smaller C-terminal domain in this region adopts a frataxin-like fold and has been shown to bind purine-rich RNA sequences in SARS-CoV .

The nsp3 assists in viral polyprotein cleavage, host immune interference, and likely plays additional roles in genome replication or transcription . A possible functional site conserved among some betacoronaviruses has been identified using bioinformatics and biochemical analyses . This conservation across different coronavirus lineages suggests that this domain provides essential functions for viral replication and possibly pathogenesis .

  • How does the receptor binding domain (RBD) of HKU9 differ from other betacoronaviruses?

The putative spike (S) receptor binding domain (RBD) of BatCoV HKU9 (HKU9-RBD) is structurally and functionally distinct from other betacoronaviruses:

  • Receptor specificity: Using surface plasmon resonance (SPR), HKU9-RBD has been demonstrated to bind neither the SARS-CoV receptor ACE2 nor the MERS-CoV receptor CD26, indicating it utilizes a different cellular receptor for entry .

  • Structural uniqueness: The HKU9-RBD core subdomain fold resembles those of other betaCoV RBDs, but the external subdomain is structurally unique with a single helix, which explains its inability to interact with ACE2 or CD26 .

  • Conformational differences: Unlike other betacoronaviruses where the RBD adopts a beta-sheet topology, the HKU9 RBD external subdomain adopts a helical fold .

These differences were validated through multiple experimental approaches:

  • SPR analysis of both bacterially-expressed RBD and mammalian-expressed mFc-fused RBD proteins

  • Atomic structure determination through crystallographic methods

  • Comparative structural analysis with other betaCoV RBDs

  • What techniques are used to identify and characterize novel bat coronaviruses like HKU9?

The identification and characterization of novel bat coronaviruses involve a comprehensive workflow:

  • Sample collection:

    • Collection of rectal swab samples from bats (e.g., Rousettus leschenaulti)

    • Processing and RNA extraction from samples

  • Initial screening and identification:

    • RT-PCR using pan-coronavirus or conserved primers targeting the RNA-dependent RNA polymerase (RdRp) gene

    • Sequencing of PCR products and BLAST analysis to determine similarity to known coronaviruses

  • Complete genome sequencing:

    • Next-Generation Sequencing (NGS) of positive samples

    • Gap closure using Sanger sequencing with specific primers

    • 5'- and 3'-RACE analyses to determine the genome ends

  • Structural and functional characterization:

    • Recombinant protein expression and purification

    • Structural studies using NMR spectroscopy or X-ray crystallography

    • Functional assays such as receptor binding studies using surface plasmon resonance

    • Serological assays using recombinant viral proteins

  • Bioinformatic analyses:

    • Sequence comparisons and phylogenetic analyses

    • Recombination analysis using specialized software

    • Prediction of protein domains and functional sites

  • How is HKU9 classified within the coronavirus taxonomy?

Bat coronavirus HKU9 (Ro-BatCoV HKU9) is classified as follows:

  • Family: Coronaviridae

  • Genus: Betacoronavirus

  • Subgroup: D (also referred to as lineage D)

HKU9 represents a distinct phylogenetic group within betacoronaviruses. According to the criteria defined by the International Committee of Taxonomy of Viruses (ICTV), a novel coronavirus represents a separate species if its amino acid sequence identity in the seven conserved replicase domains (including the RNA-dependent RNA polymerase gene) differs from known coronaviruses by more than 10% .

Multiple studies involving sequence and phylogenetic analyses have consistently placed HKU9 in betacoronavirus subgroup D, which is distinct from:

  • Subgroup A (including HCoV-HKU1)

  • Subgroup B (including SARS-CoV and SARS-related bat coronaviruses)

  • Subgroup C (including MERS-CoV, Ty-BatCoV HKU4, and Pi-BatCoV HKU5)

Western blot assays using recombinant nucleocapsid (N) proteins have confirmed that antibody reactions are subgroup-specific, supporting the classification of HKU9 as a separate subgroup within betacoronaviruses .

Advanced Research Questions

  • What methodological approaches are effective for studying potential recombination events in bat coronaviruses?

Investigating recombination events in bat coronaviruses requires a multi-faceted approach:

  • Genome sequencing and comparative analysis:

    • Complete genome sequencing of multiple strains from the same virus species

    • Identification of distinct genotypes within the same host population

    • Using degenerate/genome-specific primers with overlapping sequences confirmed by specific PCR

  • Bioinformatic analysis for recombination detection:

    • Sequence alignment of multiple complete genomes

    • Recombination analysis using specialized software to identify potential breakpoints

    • Phylogenetic analysis of individual genes or genome regions to detect incongruent evolutionary patterns

  • Experimental validation of co-infection:

    • RT-PCR with gene-specific primers to detect multiple virus genotypes

    • Sequencing of multiple clones from individual samples

    • Western blot and enzyme immunoassays to detect antibodies against specific viral proteins

  • Cell culture experiments:

    • Co-infection studies in specific bat cell lines using different coronavirus strains

    • Investigation of viral replication, recombination frequency, and progeny virus characteristics

For example, in studies of Ro-BatCoV HKU9, evidence of multiple genotypes co-existing in the same bat was found through sequencing of complete RNA-dependent RNA polymerase (RdRp), spike (S), and nucleocapsid (N) genes from multiple bats. Recombination analysis using eight Ro-BatCoV HKU9 genomes revealed possible recombination events between strains from different bat individuals .

  • How can researchers investigate the functional significance of conserved domains in nsp3 of HKU9?

To investigate the functional significance of conserved domains in nsp3 of HKU9:

  • Structural characterization and comparison:

    • Determine high-resolution structures using NMR spectroscopy or X-ray crystallography

    • Compare structural features with homologous domains from other coronaviruses

    • Identify conserved surface patches that may represent functional sites

  • Bioinformatic prediction of functional sites:

    • Multiple sequence alignment of nsp3 from different coronaviruses

    • Identification of highly conserved residues that may be functionally important

    • Prediction of potential protein-protein or protein-nucleic acid interaction sites

  • Biochemical and functional assays:

    • Protein-protein interaction studies using pull-down assays, co-immunoprecipitation, or yeast two-hybrid systems

    • RNA binding assays to investigate interactions with viral or host RNA

    • Enzymatic assays to characterize potential enzymatic activities

  • Mutagenesis approaches:

    • Site-directed mutagenesis of conserved residues

    • Expression of mutant proteins and assessment of their structural integrity

    • Functional analysis of mutants to determine the impact on specific activities

  • Reverse genetics systems:

    • Generation of recombinant viruses with mutations in nsp3

    • Analysis of viral replication, transcription, and pathogenesis

    • Identification of essential regions through deletion or substitution studies

For the SARS-unique fold in HKU9 nsp3, studies have employed solution NMR structure determination followed by bioinformatic and biochemical analyses to identify a possible functional site that is conserved among some betacoronaviruses .

  • What experimental design considerations are important when studying co-infection of multiple coronavirus genotypes in bat hosts?

Studying co-infection of multiple coronavirus genotypes in bats requires careful experimental design:

  • Sampling strategy:

    • Adequate sample size to capture population diversity

    • Systematic collection from multiple bat colonies and geographic locations

    • Longitudinal sampling to detect temporal changes in virus populations

    • Collection of both respiratory and alimentary tract samples

  • Detection methodology:

    • Use of broad-spectrum PCR primers targeting conserved regions

    • Multiple primer sets targeting different viral genes to increase detection sensitivity

    • Sequencing of multiple clones from each positive sample

    • Next-generation sequencing to detect minor variants

  • Controls and validation:

    • Inclusion of positive and negative controls in all PCR assays

    • Implementation of strict laboratory protocols to prevent cross-contamination

    • Confirmation of co-infection through independent assays (e.g., specific PCR, sequencing)

  • Comprehensive genetic characterization:

    • Complete genome sequencing of co-infecting strains

    • Analysis of key viral genes (RdRp, S, N) to identify distinct genotypes

    • Use of degenerate/genome-specific primers with overlapping sequences

  • Serological testing:

    • Development of genotype-specific serological assays

    • Testing for antibodies against multiple viral proteins

    • Western blot and enzyme immunoassays to determine seroprevalence

The study of Ro-BatCoV HKU9 demonstrated the importance of these considerations, where among 10 bats with complete RdRp, S, and N genes sequenced, three and two sequence clades for all three genes were co-detected in two and five bats, respectively, suggesting the coexistence of multiple distinct genotypes in the same bat .

  • What are the challenges and solutions in expressing and purifying recombinant nsp3 proteins from bat coronaviruses for structural studies?

Expressing and purifying recombinant nsp3 proteins from bat coronaviruses presents several challenges:

Challenges:

  • Size and complexity: Full-length nsp3 is large and multi-domain, making it difficult to express in soluble form

  • Protein folding: Ensuring proper folding of individual domains or the complete protein

  • Solubility: Many viral proteins tend to aggregate or form inclusion bodies

  • Post-translational modifications: Some functions may require specific modifications

  • Stability: Maintaining protein stability during purification and subsequent analyses

Solutions and methodological approaches:

  • Expression strategy:

    • Domain-based approach: Express individual domains separately (e.g., the C domain spanning residues 573-646 of HKU9 nsp3)

    • Codon optimization: Use of synthetic genes with codons optimized for the expression host

    • Fusion tags: Addition of solubility-enhancing tags (e.g., His-tag, MBP, GST)

    • Expression hosts: Testing multiple expression systems (E. coli, insect cells, mammalian cells)

  • Purification protocol:

    • Multi-step purification: Combination of affinity chromatography, ion exchange, and size exclusion

    • On-column refolding: For proteins expressed in inclusion bodies

    • Optimization of buffer conditions: pH, salt concentration, additives to enhance stability

    • Tag removal: Specific protease cleavage to remove fusion tags

  • Quality control:

    • Assessment of protein folding using circular dichroism or fluorescence spectroscopy

    • Size exclusion chromatography to verify monodispersity

    • Mass spectrometry to confirm protein identity and modifications

    • Activity assays to verify functional integrity

  • Structural biology considerations:

    • Sample preparation for NMR: Isotopic labeling with 15N and 13C

    • Optimization of protein concentration, temperature, and buffer conditions

    • Screening of crystallization conditions for X-ray crystallography

For example, in the structural study of HKU9 nsp3, the construct used contained the entire predicted C domain (residues 573-646) with additional N-terminal residues derived from fusion tag cleavage. The protein was expressed in E. coli and isotopically labeled for NMR studies .

  • How can researchers determine the host range and receptor usage of novel bat coronaviruses like HKU9?

Determining host range and receptor usage of novel bat coronaviruses involves multiple complementary approaches:

  • Receptor binding studies:

    • Expression and purification of recombinant receptor binding domain (RBD) proteins

    • Surface plasmon resonance (SPR) to test binding to known coronavirus receptors (e.g., ACE2, CD26)

    • Using both bacterially-expressed and mammalian-expressed proteins to account for post-translational modifications

    • Comparative binding studies with RBDs from coronaviruses with known receptor usage

  • Structural characterization:

    • Determination of RBD crystal structure to identify unique features

    • Comparison with other coronavirus RBDs to predict receptor binding interfaces

    • Analysis of core and external subdomains that may determine receptor specificity

  • Cell entry assays:

    • Pseudotyped virus systems expressing the spike protein of interest

    • Infection assays using cell lines from different species

    • Virus-cell fusion assays to monitor entry mechanisms

    • Competition assays with soluble receptors or receptor-blocking antibodies

  • Viral isolation attempts:

    • Testing multiple cell lines from different species (e.g., Vero E6, BHK-21, MDCK, A549, HEp-2, CaCo-2, bat cell lines)

    • Multiple blind passages to allow for potential adaptation

    • Monitoring for cytopathic effects and viral replication

  • Receptor identification:

    • Virus overlay protein binding assay (VOPBA) to identify potential receptors

    • Affinity purification using viral proteins as bait

    • Mass spectrometry to identify interacting host proteins

    • CRISPR-Cas9 screening to identify essential host factors

In the case of HKU9, studies demonstrated that its RBD does not bind to ACE2 or CD26 (receptors used by SARS-CoV and MERS-CoV, respectively), suggesting it uses a different cellular receptor. The unique structural features of the HKU9 RBD, particularly its external subdomain with a single helix instead of a beta-sheet topology, explain this receptor specificity .

  • What bioinformatic approaches are most effective for identifying conserved functional sites in coronavirus nsp3 proteins?

Effective bioinformatic approaches for identifying conserved functional sites in nsp3 include:

  • Sequence-based methods:

    • Multiple sequence alignment (MSA) of nsp3 proteins across coronavirus species and genera

    • Identification of highly conserved residues or motifs

    • Calculation of conservation scores using algorithms like ConSurf or Rate4Site

    • Prediction of functional residues based on evolutionary conservation patterns

  • Structure-based methods:

    • Homology modeling of uncharacterized domains based on known structures

    • Structural alignment of homologous domains to identify conserved three-dimensional features

    • Surface mapping of conserved residues to identify potential functional patches

    • Pocket detection algorithms to identify potential binding sites or catalytic sites

  • Integrative approaches:

    • Combining sequence conservation with structural information

    • Correlated mutation analysis to identify co-evolving residues

    • Molecular dynamics simulations to identify stable interaction networks

    • Electrostatic potential mapping to identify potential nucleic acid binding regions

  • Machine learning and network analysis:

    • Prediction of protein-protein interaction sites

    • Functional site prediction using neural networks or support vector machines

    • Protein interaction network analysis to predict functional associations

  • Experimental validation of predictions:

    • Targeted mutagenesis of predicted functional sites

    • Biochemical assays to assess the impact on specific activities

    • Structural studies of mutant proteins to confirm the importance of identified sites

For the SARS-unique fold in HKU9 nsp3, bioinformatic analyses combined with structural information were used to identify a possible functional site that is conserved among betacoronaviruses. This integrated approach provided insights into potential functions of this domain that would not be apparent from sequence analysis alone .

  • What are the implications of heterologous recombination events for coronavirus evolution and emergence?

Heterologous recombination events have significant implications for coronavirus evolution and emergence:

  • Generation of genetic diversity:

    • Acquisition of novel genes or domains from distantly related viruses

    • Introduction of new functional capabilities

    • Rapid adaptation to new ecological niches or hosts

  • Mechanisms of cross-species transmission:

    • Acquisition of genes that modify host range

    • Changes in receptor binding specificity

    • Alteration of immune evasion capabilities

  • Evolutionary consequences:

    • Acceleration of viral evolution beyond the rate of mutation

    • Creation of novel virus lineages with unique properties

    • Potential emergence of viruses with enhanced pathogenicity

  • Examples and evidence:

    • The HE gene in betacoronavirus group A, potentially derived from influenza C virus

    • The p10 gene in Ro-BatCoV GCCDC1, likely acquired from a bat orthoreovirus

    • Coexistence of different genotypes in the same bat host, facilitating recombination

  • Contributing factors:

    • Co-circulation of phylogenetically distinct viruses in bat populations

    • Co-infections of single host cells, a prerequisite for recombination

    • Dense roosting behavior and long foraging range of bats facilitating virus exchange

The discovery of Ro-BatCoV GCCDC1, with a p10 gene likely derived from an ancestral orthoreovirus, provides strong evidence for inter-family recombination between a single-stranded, positive-sense RNA virus and a double-stranded segmented RNA virus. This case demonstrates the potential for coronaviruses to acquire novel genetic material through heterologous recombination, which could contribute to their adaptation and emergence as human pathogens .

Research Data and Experimental Approaches

  • Comparative structural features of HKU9 nsp3 C domain and related coronavirus proteins:

FeatureHKU9 nsp3 C domainSARS-CoV nsp3 SUD-COther betaCoV nsp3
Fold typeFrataxin/double-wing motifFrataxin/double-wing motifVariable by subgroup
Secondary structureα + β foldα + β foldDependent on domain
Residue range573-646 (nsp3)Similar C-terminal domainVariable
Polyprotein location1345-1418 (pp1ab)C-terminal part of SUDVariable
Binding propertiesPotential RNA/protein bindingBinds purine-rich RNAVariable
Functional significanceEssential for viral replicationEssential for viral replicationVariable
ConservationConserved in betaCoV group DPresent in SARS-CoVVariable distribution
  • Experimental protocols for recombinant protein expression and structural studies:

Key methodological steps for structural characterization of HKU9 nsp3 domains:

  • Gene synthesis and cloning:

    • DNA sequence encoding the target domain obtained as codon-optimized synthetic gene

    • Cloning into expression vector with appropriate purification tag

  • Protein expression:

    • Expression in E. coli (for NMR studies)

    • Isotopic labeling with 15N and 13C for NMR experiments

    • Alternative expression in mammalian cells for functional studies

  • Protein purification:

    • Affinity chromatography using His-tag

    • Tag cleavage and further purification steps

    • Final protein containing the entire predicted domain plus tag-derived residues

  • NMR spectroscopy:

    • Assignment of 96% of observable resonances

    • 3D 15N- and 13C-resolved [1H,1H] NOESY experiments

    • Structure determination and refinement

  • Functional characterization:

    • Surface plasmon resonance for interaction studies

    • Bioinformatic analysis to identify potential functional sites

    • Biochemical assays to validate predicted functions

  • Detection of coronavirus genotypes and recombination events:

In studies of Ro-BatCoV HKU9, multiple genotypes were detected in the same bat hosts using the following approach:

  • Sample collection and processing:

    • 175-350 bat samples collected and processed

    • RNA extraction from rectal swabs

  • Detection and genotyping:

    • RT-PCR targeting conserved regions

    • Sequencing of RdRp, spike (S), and nucleocapsid (N) genes

    • Identification of distinct sequence clades

  • Confirmation of co-infection:

    • Complete genome sequencing of distinct genotypes from the same bat

    • Use of degenerate/genome-specific primers with overlapping sequences

    • Confirmation by specific PCR

  • Recombination analysis:

    • Analysis using eight Ro-BatCoV HKU9 genomes

    • Identification of possible recombination events between strains

    • Detection of recombination breakpoints

  • Serological testing:

    • Western blot assays using recombinant N proteins

    • Enzyme immunoassays for antibody detection

    • Determination of seroprevalence (43-64% in tested populations)

This comprehensive approach has provided valuable insights into the genetic diversity, evolution, and potential recombination mechanisms of bat coronaviruses, with important implications for understanding their potential for cross-species transmission and emergence as human pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.