Recombinant Bat coronavirus Rp3/2004 Membrane protein (M)

Shipped with Ice Packs
In Stock
Cat. No.
BT2451891
Source
in vitro E.coli expression system
Synonyms
M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Quick Inquiry

Description

Introduction to Recombinant Bat Coronavirus Rp3/2004 Membrane Protein (M)

Recombinant Bat coronavirus Rp3/2004 Membrane protein (M) is a protein expressed by the Rp3/2004 bat coronavirus . Coronaviruses possess structural proteins, including Spike (S), Envelope (E), Membrane (M), and Nucleocapsid (N) . The membrane protein (M) is a key structural component in coronaviruses.

Role in Viral Replication and Pathogenesis

The membrane protein (M) plays a significant role in the assembly, budding, and pathogenesis of coronaviruses . Relevant research has shown:

  • Coronaviruses utilize their structural proteins to enter cells and replicate effectively .

  • Studies on related SARS-like coronaviruses (SL-CoVs) indicate that the M protein, along with other proteins, contributes to the virus's ability to infect and replicate in different cell types .

Receptor Binding and Cell Entry

The ability of a coronavirus to bind to a host cell receptor is crucial for its infectivity. Research on Rp3/2004 and similar viruses has revealed:

  • Rp3/2004's spike protein cannot use ACE2 for cell entry, irrespective of the ACE2 molecule's origin .

  • Introduction of a segment from the SARS-CoV spike protein into Rp3-S enables the resulting protein to mimic SARS-CoV in receptor usage .

  • Key residues in the receptor-binding domain (RBD) of related SARS-like bat coronaviruses, such as Rs3367, are conserved and maintain critical ACE2 contacts .

Evolutionary and Recombination Events

The Rp3/2004 coronavirus and related viruses have undergone recombination events, leading to genetic diversity:

  • Bat coronaviruses, including Rp3/2004, are subject to recombination, as seen in the identification of novel coronaviruses with genes from other viruses .

  • Recombination events can lead to the integration of unique genes, such as the p10 gene from a bat orthoreovirus, into the coronavirus genome, influencing viral evolution .

Potential for Human Emergence

Studies emphasize the potential for bat coronaviruses to evolve and emerge in humans:

  • SARS-like coronaviruses found in bats show a potential risk for human emergence .

  • Research into the spike protein of bat coronaviruses has revealed similarities in key receptor-binding residues when compared to SARS-CoV-2 .

Research Findings

StudyKey Findings
Synthetic Recombinant Bat SARS-like Coronavirus Is Infectious in Cells Bat-SCoV expressing the SARS-CoV RBD can enter cells using ACE2 from humans, primates, or civets and replicate efficiently.
Isolation and Characterization of a Bat SARS-like Coronavirus That Uses the ACE2 Receptor Notable sequence differences exist in the RBD regions of SARS-like coronaviruses (SL-CoVs), with higher amino acid sequence identity to SARS-CoV.
A Bat-Derived Putative Cross-Family Recombinant Coronavirus with a Reovirus Gene A novel coronavirus, Ro-BatCoV GCCDC1, contains a unique gene integrated from a bat orthoreovirus, demonstrating a heterologous inter-family recombination event.
Difference in Receptor Usage between Severe Acute Respiratory Syndrome Coronavirus and Severe Acute Respiratory Syndrome-Like Coronavirus of Bat Origin Bat SL-CoV (Rp3) S protein cannot use ACE2 for cell entry, regardless of the ACE2 molecule's origin; the chimeric-construct analysis suggests that the Rp3-S gene was intact and would be functional if an appropriate receptor was identified.
Identification of a SARS-like bat coronavirus that shares structural features with the spike glycoprotein receptor-binding domain of SARS-CoV-2 SARS-like bat coronavirus Rs3367 has the most conserved residues compared to SARS-CoV-2.
Genomic Characterization of Severe Acute Respiratory Syndrome-Related Coronavirus in Bats from Yunnan Province, China BtCoV/Rp3/Rhi pea/China/2004, closely related to human SARS CoV, was 78.0% identical and 86.8% similar to SARS CoV in the whole Spike protein.
A SARS-like cluster of circulating bat coronaviruses shows potential for human emergence SARS-like coronaviruses found in bats show a potential risk for human emergence.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Bat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3)
Target Names
M
Target Protein Sequence
MAENGTISVEELKRLLEQWNLVIGFIFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVT LACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNPETNILLN VPLRGTILTRPLMESELVIGAVIIRGHLRMAGHSLGRCDIKDLPKEITVATSRTLSYYKL GASQRVGTDSGFAAYNRYRIGNYKLNTDHSGSNDNIALLVQ
Uniprot No.
Q3I5J2

Target Background

Function
A viral envelope component crucial for virus morphogenesis and assembly through interactions with other viral proteins.
Protein Families
Betacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.