Recombinant Bat coronavirus Rp3/2004 Protein 3 (3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bat Coronavirus Rp3/2004 Protein 3 (3)

"Recombinant Bat coronavirus Rp3/2004 Protein 3 (3)" refers to a protein derived from the Bat coronavirus Rp3/2004 strain, which has been produced using recombinant DNA technology . Recombinant proteins are created by introducing the gene encoding the protein of interest into a host organism (e.g., E. coli) that can then produce the protein in large quantities .

Origin and Significance

Bat coronaviruses are of interest because bats are natural reservoirs for many coronaviruses, including those related to SARS-CoV and SARS-CoV-2 . Rp3/2004 is a bat SARS-like coronavirus (SL-CoV) that has been identified as a possible recombinant virus . This means that its genome may have originated from two different bat coronavirus strains . Understanding the properties of Rp3/2004 and its proteins can provide insights into the evolution and transmission potential of coronaviruses .

Recombinant Production

The recombinant form of Bat coronavirus Rp3/2004 Protein 3 is typically produced in a host organism like E. coli . The full-length membrane protein (M) of the Bat coronavirus Rp3/2004, tagged with histidine (His), is expressed in E. coli . The recombinant protein is purified and made available in lyophilized form for research purposes .

Role in Viral Pathogenesis

Non-structural proteins of coronaviruses, such as non-structural protein 6, can be determinants of virus virulence . Some coronavirus proteins can stimulate cellular DNA synthesis in vitro and are found in the host endoplasmic reticulum membrane, suggesting their involvement in modulating host cell processes .

Rp3/2004 as a Recombinant Virus

Evidence suggests that Bt-SLCoV Rp3 is a recombinant of a Bt-SLCoV strain and a strain that is closely related to Hu-SCoVs . The phylogenetic origin of the potential parents shows that the minor parental region of Rp3 clustered within the Bt-SLCoV lineage and shared monophyly with Rm1 and BtCoV/279/2005 .

Research Applications

Recombinant Bat coronavirus Rp3/2004 Protein 3 is used in research to understand the structural and functional characteristics of coronaviruses. These proteins are critical for studying viral entry, replication, and interactions with the host immune system .

Table: Sequence Identities of Spike-Protein Regions

CoronavirusSequence Identity (%)
RaTG1397.56
ZC4582.30
RsSHC01477.94
Rs336777.70

Table: Conserved Residues in ACE2-Binding

CoronavirusConserved Residues
Rs33674
RaTG132
ZC451
RsSHC0141

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
3; Protein 3; Accessory protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Bat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3)
Target Names
3
Target Protein Sequence
MDLFMSIFTLGAITRQPAKIENASPASTVHATATIPLQASLPFGWLVVGVALLAVFQSAS KVIALHKRWQLALHKGIQLVCNLLLLFVTIYSHLLLLAAGMEAQFLYIYALIYILQIVSF CRFIMRCWLCWKCRSKNPLLYDANYFVCWHTNCFDYCIPYNSITDTIVLTSGDGTTQPKL KEDYQIGGYSEDWHSGVKDYVVIHGYFTEVYYQLESTQLSTDTGAENATFFIYSKLVKDV DHVQIHTIDGSSGVVNPAMDPIYDEPTTTTSVPL
Uniprot No.

Target Background

Function
This protein forms homotetrameric potassium-sensitive ion channels (viroporins) and may modulate virus release. It upregulates the expression of fibrinogen subunits FGA, FGB, and FGG in host lung epithelial cells, induces apoptosis in cell culture, and downregulates the type 1 interferon receptor by inducing serine phosphorylation within the IFNα-receptor subunit 1 (IFNAR1) degradation motif and increasing IFNAR1 ubiquitination.
Subcellular Location
Virion. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein. Secreted. Host cytoplasm.

Q&A

What is Bat Coronavirus Rp3/2004 and what is its phylogenetic significance?

Bat coronavirus Rp3/2004 is a SARS-like coronavirus (SL-CoV) identified in horseshoe bats that represents one of the reservoir populations from which SARS-CoV potentially emerged . Phylogenetic analysis reveals that Rp3 has a recombinant genome with evidence of genetic exchange between bat SARS-like coronaviruses and strains closely related to human SARS-CoV . Unlike many other bat coronaviruses, Rp3 was not isolated in culture but was characterized through direct sequencing of PCR products amplified from field samples . Its significance lies in helping elucidate the evolutionary pathway that may have led to the emergence of SARS-CoV in humans, providing evidence that recombination events in coronaviruses can generate strains with novel properties.

What unique features are found in the receptor-binding domain of Rp3/2004?

The receptor-binding domain (RBD) of Rp3/2004's spike protein exhibits distinctive features that impact its host tropism. Unlike human SARS-CoV, Rp3 contains significant amino acid deletions in two critical motifs (amino acids 433-437 and 460-472) within the RBD region . These deletions are functionally significant as they prevent Rp3 from binding to human ACE2, the receptor used by SARS-CoV for cell entry . Structural analysis comparing the RBD of Rp3 with that of SARS-CoV reveals these differences clearly affect the three-dimensional conformation of the protein, as demonstrated by predicted protein structure modeling . This difference in RBD structure explains why Rp3, unlike some more recently discovered bat coronaviruses (such as Rs3367), cannot directly infect human cells through the ACE2 receptor without adaptation.

What evidence supports the recombinant origin of Rp3/2004, and what are the identified breakpoints?

Multiple computational analyses provide strong evidence for the recombinant origin of Rp3/2004. Initial RDP (Recombination Detection Program) analysis suggested that Rp3 may be a recombinant between a bat SARS-like coronavirus strain and a strain closely related to human SARS-CoV . This was further supported by similarity plot analyses showing differential sequence relationships across the genome. Statistical validation using likelihood ratio (LR) tests confirmed that the observed phylogenetic discordance was not due to chance but represented a genuine recombination event .

The primary recombination breakpoint was identified at the junction between the S (spike) and ORF1b coding regions . The statistical significance of this breakpoint was established through comparative analysis with simulated data sets, yielding p-values < 0.0001. The recombination resulted in two major parental regions: an approximately 21 kb region derived from a lineage related to human SARS-CoV and an 8 kb region derived from bat SARS-like coronaviruses . This pattern is consistent with the known propensity for recombination within the Spike gene region of coronaviruses, as recombination within Spike has been frequently documented in coronavirus evolution .

How does the Rp3/2004 recombination pattern compare to other bat SARS-like coronaviruses?

The recombination pattern observed in Rp3/2004 represents a distinct evolutionary pathway compared to other bat SARS-like coronaviruses. While Rp3 shows evidence of a single major recombination breakpoint, more recently discovered bat coronaviruses like Rs3367 and RsSHC014 exhibit more complex recombination patterns with multiple breakpoints . For example, analysis of Rs3367 revealed three breakpoints (at nucleotides 20,827, 26,553, and 28,685) that generated recombination fragments covering different genomic regions (including partial ORF1b, full-length S, ORF3, E, partial M gene, and other downstream regions) .

Phylogenetic analysis comparing the major and minor parental regions suggests that while Rp3 is a recombinant between bat SARS-like coronaviruses and strains related to human SARS-CoV, newer strains like Rs3367 appear to be descendants of recombination events between lineages that ultimately led to SARS-CoV and other bat coronaviruses like Rs672 . This indicates that multiple, possibly independent, recombination events involving different parental strains have occurred during the evolution of bat SARS-like coronaviruses, creating a complex web of evolutionary relationships.

What mechanisms might explain the differential ACE2 binding capabilities among bat SARS-like coronaviruses?

The differential ACE2 binding capabilities among bat SARS-like coronaviruses can be attributed to specific structural variations in their receptor-binding domains (RBDs). These variations arise through several mechanisms, including:

  • Critical Residue Substitutions: Structural and mutagenesis studies have identified five key residues (amino acids 442, 472, 479, 487, and 491) in the RBD of SARS-CoV spike protein that play pivotal roles in receptor binding . In bat coronaviruses like Rp3, these residues differ significantly from those in SARS-CoV, directly impacting ACE2 binding affinity.

  • Deletion Mutations: Rp3 and similar bat SARS-like CoVs contain deletions in two critical motifs (amino acids 433-437 and 460-472) compared to SARS-CoV . These deletions structurally alter the RBD architecture, preventing effective interaction with human ACE2.

  • Recombination Events: More recently discovered bat coronaviruses like Rs3367 have acquired SARS-CoV-like sequences in their RBDs through recombination, resulting in conservation of some key residues (two of the five critical residues in Rs3367 match those in SARS-CoV) . This partial conservation enables these viruses to bind human ACE2, unlike Rp3.

  • Selection Pressure: During adaptation to new hosts, coronaviruses undergo selection pressure that favors mutations enhancing receptor binding affinity. This is evident in the evolution of SARS-CoV during the outbreak, where changes in the RBD allowed for more efficient use of human ACE2 .

These mechanisms collectively demonstrate how coronaviruses can acquire host range adaptations through genetic recombination and mutation, potentially enabling cross-species transmission.

What techniques are most effective for detecting recombination events in coronavirus genomes?

Detecting recombination events in coronavirus genomes requires a multi-faceted approach combining various computational and statistical methods. Based on the analyzed research, the most effective methodology includes:

  • Recombination Detection Program (RDP) Analysis: This approach utilizes multiple algorithms in parallel (RDP, GENECONV, BootScan, maximum chi square, Chimera, SISCAN, and 3SEQ methods) to identify potential recombination events . When applying RDP, a Bonferroni corrected P-value cut-off of 0.01 is recommended for reliable detection of recombination signals .

  • Similarity Plot Analysis: This graphical approach visualizes sequence similarity across a genome alignment, making it possible to identify regions where sequence relationships change abruptly - a signature of recombination. For Rp3/2004, similarity plots clearly showed the 5′ region having higher similarity with human SARS-CoVs while the 3′ region aligned more closely with bat SARS-like CoVs .

  • Bootscan Analysis: This method detects changes in phylogenetic clustering patterns along a sequence alignment through bootstrap resampling. When applied to Rp3/2004, bootscan analysis revealed discordance of phylogenetic signals between different genomic regions, supporting the recombination hypothesis .

  • Likelihood Ratio Tests: Statistical validation using likelihood ratio tests comparing actual data against simulated non-recombinant datasets provides rigorous confirmation of potential breakpoints. In the case of Rp3, the LR for the putative breakpoint exceeded any LRs from corresponding simulated data sets, strongly supporting the recombination event .

  • Bayesian Markov Chain Monte Carlo (BMCMC) Phylogenies: Constructing separate phylogenies based on the major and minor parental regions helps identify the likely parental lineages involved in the recombination event .

When applying these methods to coronavirus genomic data, it is essential to conduct thorough initial sequence alignment using tools like ClustalW v.2.0, as the quality of the alignment directly impacts recombination detection .

How can researchers differentiate between natural recombination events and laboratory artifacts in coronavirus genomic analyses?

Differentiating natural recombination events from laboratory artifacts in coronavirus genomic analyses requires careful methodological considerations and validation procedures:

  • Sample Acquisition and Processing Controls: For direct field samples like those used to sequence Rp3/2004, documentation of the collection process, including sterile techniques and sample preservation methods, helps rule out contamination during collection . Researchers should ensure that the genome was assembled from sequences of overlapping PCR products with appropriate controls for each step.

  • Statistical Validation: Apply rigorous statistical validation to potential recombination breakpoints. The Rp3 study used likelihood ratio tests comparing observed data against simulated data sets, demonstrating that the recombination signal was not due to chance (p < 0.0001) .

  • Recombination Breakpoint Distribution Analysis: Natural recombination in coronaviruses tends to occur at specific hotspots, particularly around the Spike gene region. Multiple breakpoints randomly distributed throughout the genome may suggest laboratory artifacts or template switching during PCR .

  • Phylogenetic Consistency: Analyze whether the recombination pattern is consistent with established phylogenetic relationships. For Rp3/2004, the minor parental region clustered appropriately within the expected Bt-SLCoV lineage and shared monophyly with related viruses (Rm1 and BtCoV/279/2005) .

  • Multiple Detection Methods: Apply diverse recombination detection methods (RDP, Bootscan, Simplot, etc.) and assess concordance between them. Agreement across different methodological approaches strengthens confidence in detected recombination events .

  • Host Species Consideration: Evaluate whether the recombination pattern aligns with known host species restrictions. Species-specific host restriction of CoVs in bats has been documented, with most CoVs from a single bat species grouping together in phylogenetic analyses .

When the Rp3/2004 genome was analyzed, researchers recognized it was not plaque isolated but directly sequenced from field samples. They specifically addressed potential concerns by noting that "only one recombination breakpoint was identified within the 29-kb genome, and its parental regions are relatively long (about 21 and 8 kb)" and concluded that "the probability that the detected recombination breakpoint is an artifact should be negligible" .

What methodological approaches are used to predict and test the receptor binding capabilities of novel bat coronaviruses?

Predicting and testing receptor binding capabilities of novel bat coronaviruses involves a complementary set of computational, structural, and experimental approaches:

  • Sequence Alignment and Comparative Analysis: Initial assessment begins with amino acid sequence alignments of RBD sequences from the novel virus with those of known receptor-binding capabilities. For example, comparing the RBD sequences of SARS-CoV, SARS-like CoVs, and novel bat coronaviruses reveals critical differences, such as the deletions in amino acids 433-437 and 460-472 in Rp3 compared to SARS-CoV .

  • Structural Prediction and Modeling:

    • Predicted protein structures of the RBD can be generated using tools like ProMod3 on SWISS-MODEL server based on target-template alignment .

    • The global and per-residue model quality can be assessed using scoring functions such as QMEAN .

    • Comparison of predicted structures with crystal structures of reference proteins (e.g., SARS-CoV RBD alone or complexed with human ACE2) provides insights into potential binding capabilities .

  • Identification of Critical Binding Residues: Based on previously conducted mutagenesis studies, five key residues (amino acids 442, 472, 479, 487, and 491) in the SARS-CoV RBD have been identified as critical for ACE2 binding. Analyzing these positions in novel coronaviruses provides preliminary assessment of binding potential .

  • Synthetic Recombinant Virus Construction: To directly test binding capabilities, researchers can employ reverse genetics to generate chimeric viruses. For example, replacing the RBD of a bat coronavirus with that of SARS-CoV (as in the Bat-SRBD construct) allows testing whether the chimeric virus can infect cells expressing human ACE2 .

  • Cell Culture Infectivity Assays: Testing the ability of natural or synthetic viruses to infect cells expressing various species' ACE2 receptors provides direct evidence of receptor usage .

  • Neutralization Assays: Determining whether antibodies against known coronavirus spike proteins can neutralize novel viruses offers insights into structural similarities in the receptor-binding regions .

This multi-faceted approach has proven effective in characterizing novel coronaviruses. For instance, while initial analyses showed Rp3 could not use human ACE2 as a receptor, later-discovered bat coronaviruses like Rs3367 contained RBDs similar to SARS-CoV and could bind human ACE2, demonstrating how these methodologies help track the evolutionary development of receptor binding capabilities among emerging coronaviruses .

What does Rp3/2004 tell us about the evolutionary origins of SARS-CoV and potential future zoonotic coronaviruses?

Rp3/2004 provides critical insights into the evolutionary pathway of SARS-CoV and has significant implications for understanding potential future zoonotic events:

These findings collectively suggest that continuous surveillance of bat coronavirus populations, particularly focusing on recombination events and RBD variations, is essential for predicting and potentially preventing future coronavirus zoonoses.

How can structural knowledge of Rp3/2004 Protein 3 inform therapeutic and vaccine development strategies?

Structural knowledge of Rp3/2004 and its proteins offers valuable insights for therapeutic and vaccine development strategies:

  • Conserved Target Identification: By comparing Rp3/2004 proteins with those of pathogenic human coronaviruses, researchers can identify highly conserved regions that make ideal targets for broad-spectrum antiviral development. For example, the nsp7 and E proteins show 100% amino acid similarity between some bat coronaviruses and SARS-CoV-2, making them potential targets for pan-coronavirus therapeutics .

  • Receptor Binding Domain Variations: Understanding the structural differences in the RBD between Rp3 (which cannot bind human ACE2) and SARS-CoV (which can) helps identify critical residues and structural elements essential for receptor binding . This knowledge can guide the design of therapeutic antibodies or small molecules that block this interaction across multiple coronaviruses.

  • Recombination-Resistant Vaccine Design: The propensity for recombination in coronaviruses, as demonstrated by Rp3/2004, suggests that vaccines targeting multiple antigenic sites might be more resistant to escape through recombination events . Incorporating conserved epitopes from both the S1 and S2 subunits of the spike protein could provide broader protection.

  • Synthetic Recombinant Approaches: The successful creation of chimeric viruses (like the Bat-SRBD construct, which replaced the Bat-SCoV RBD with the SARS-CoV RBD) demonstrates a methodology for testing vaccine candidates against potential future zoonotic coronaviruses . This approach allows for rapid adaptation of existing vaccines to address emerging viral threats.

  • Cross-Neutralization Studies: Research on Rp3 and related viruses has shown that antibodies specific for both bat and human coronavirus spike proteins can neutralize chimeric viruses . This suggests that properly designed vaccines might confer protection against both existing and emerging coronaviruses.

By leveraging structural insights from Rp3/2004 and other bat coronaviruses, researchers can develop more effective and broadly protective coronavirus countermeasures, potentially mitigating the impact of future outbreaks caused by novel zoonotic coronaviruses.

What are the current limitations in Rp3/2004 research and how might they be addressed in future studies?

Current research on Rp3/2004 faces several significant limitations that future studies should address:

  • Lack of Culturable Virus: One fundamental limitation is that Rp3/2004 has not been successfully cultured in laboratory settings. The genome was obtained through direct sequencing of PCR products from field samples rather than from isolated virus . Future research should focus on developing improved culture systems for bat coronaviruses, possibly using organoid models or genetically modified cell lines expressing relevant bat receptors.

  • Limited Understanding of Natural Host Biology: While Rp3 was identified in horseshoe bats, our understanding of the virus-host interaction in its natural environment remains limited. Future studies should incorporate more detailed analysis of bat immunology, physiology, and ecological factors that influence viral persistence and evolution in these natural reservoirs.

  • Mixed Population Concerns: As noted in the original research, "if the host was infected by multiple strains, we cannot exclude the possibility that the Rp3 genome represents a mosaic sequence of a number of strains" . More sophisticated single-virus genomic approaches and deeper sequencing of bat samples could help resolve this uncertainty and provide clearer evolutionary histories.

  • Incomplete Receptor Interaction Data: While we know Rp3 cannot use human ACE2 as a receptor, the actual receptor used by this virus in its natural host remains unidentified. Future studies should aim to characterize the complete receptor utilization profile of Rp3/2004 and related viruses in various host species.

  • Temporal Evolutionary Context: Most analyses of Rp3 are based on samples collected at a single time point. Longitudinal sampling and sequencing of bat coronavirus populations would provide valuable insights into the dynamics of recombination and evolution over time.

  • Functional Characterization of Non-Structural Proteins: While much attention has focused on the spike protein and its receptor binding domain, other proteins, including the non-structural protein 3 (nsp3), also show significant differences between bat SARS-like CoVs and SARS-CoVs . Comprehensive functional characterization of these proteins would enhance our understanding of their roles in viral replication, pathogenesis, and host adaptation.

Addressing these limitations would require interdisciplinary collaboration between virologists, ecologists, structural biologists, and computational scientists, potentially employing new technologies such as cryo-electron microscopy, advanced bioinformatics, and innovative in vitro and in vivo models of bat coronavirus infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.