Recombinant Bat coronavirus Rp3/2004 Protein 7a (7a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you require a specific format, please indicate your preference in the order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice is required, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
7a; Protein 7a; Accessory protein 7a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
16-122
Protein Length
Full Length of Mature Protein
Species
Bat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3)
Target Names
7a
Target Protein Sequence
ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTY QLRARSVSPKLFIRQEEVHQELYSPLFLIVAALVFITLCFTIKRKTE
Uniprot No.

Target Background

Function
This protein is non-structural and dispensable for viral replication in cell culture.
Subcellular Location
Virion. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein.

Q&A

What is the structural characterization of Bat coronavirus Rp3/2004 Protein 7a?

The Bat coronavirus Rp3/2004 Protein 7a belongs to the family of SARS coronavirus accessory proteins. Structurally, it shares similarities with the SARS-CoV 7a protein, which adopts a compact immunoglobulin-like β sandwich fold in its luminal domain (amino acids 16 to 80). This fold is commonly found in various proteins including cell surface receptors, transcription factors, and enzymes, though the fold itself doesn't directly indicate the protein's function. The crystallized structure reveals a protein architecture that facilitates interactions with host cellular components .

What primary functions have been identified for coronavirus 7a proteins?

Coronavirus 7a proteins, including those from bat coronaviruses, demonstrate several significant functions in viral pathogenesis:

  • Induction of apoptosis through morphological and biochemical changes

  • Inhibition of cellular gene expression at the translation level

  • Activation of stress response pathways, particularly p38 mitogen-activated protein kinase (MAPK)

  • Interaction with host proteins, notably human Ap4A-hydrolase

  • Potential involvement in viral assembly and virion structure

These functions collectively contribute to viral pathogenesis and host cell manipulation. When expressed in cells, the 7a protein induces characteristic apoptotic changes including cell rounding, shrinkage, and membrane blistering prior to cell death .

What are the established protocols for expressing and purifying recombinant Bat coronavirus Rp3/2004 Protein 7a?

Expression System Selection:
The most effective expression systems for Bat coronavirus Rp3/2004 Protein 7a include:

  • Bacterial systems (E. coli) for basic structural studies

  • Mammalian cell lines (293T, Vero E6) for functional studies requiring post-translational modifications

  • Baculovirus-insect cell systems for larger-scale production

Purification Protocol:

  • Construct expression vectors containing the 7a gene with appropriate tags (V5-His tag or GFP fusion constructs have been validated)

  • Transform/transfect into selected expression system

  • Induce protein expression (IPTG for bacterial systems, appropriate promoters for mammalian systems)

  • Lyse cells in buffer containing protease inhibitors

  • Purify using affinity chromatography (Ni-NTA for His-tagged constructs)

  • Perform size exclusion chromatography for higher purity

  • Confirm purity through SDS-PAGE and Western blotting

  • Verify functionality through appropriate assays (apoptosis detection, protein-protein interaction studies)

How can researchers effectively assess the apoptotic activity of Protein 7a in experimental settings?

Recommended Multi-parameter Approach:

  • Morphological Assessment:

    • Phase-contrast and fluorescence microscopy of cells expressing 7a-GFP fusion proteins

    • Document cell rounding, shrinkage, and membrane blistering at 24h and 48h post-transfection

    • Compare with GFP-only controls

  • Biochemical Markers:

    • Caspase-3 activation assay (fluorometric or colorimetric)

    • PARP cleavage detection via Western blot

    • Annexin V/PI staining for flow cytometry

    • DNA fragmentation assay

  • Dose-Dependent Analysis:

    • Transfect varying amounts of 7a expression construct (25-500 ng per well in 24-well plates)

    • Plot correlation between expression level and apoptotic markers

    • Establish minimum threshold for apoptosis induction

  • Time-Course Studies:

    • Harvest cells at multiple timepoints (0, 12, 24, 36, 48h post-transfection)

    • Document progression of apoptotic markers

The combined approach allows for comprehensive characterization of apoptotic activity, with studies showing detectable caspase-3 activation with as little as 25 ng of 7a-GFP per well, and maximal activation at approximately 100 ng per well .

How does Protein 7a interact with the host translational machinery to inhibit protein synthesis?

Protein 7a exhibits a sophisticated mechanism for inhibiting host cell translation that does not involve transcription or nucleocytoplasmic transport inhibition. Current research indicates the following mechanistic pathway:

  • Direct Translation Inhibition: 7a protein specifically inhibits expression from mRNA constructs designed to measure translation, while showing no significant effect on transcription or nucleocytoplasmic transport processes

  • Potential Mechanisms:

    • Interaction with translation initiation factors (potentially eIF3 or eIF4G)

    • Binding to ribosomal subunits to prevent assembly

    • Sequestration of essential translation components in subcellular compartments

  • Stress Response Activation: The translational inhibition leads to activation of cellular stress responses, particularly the p38 MAPK pathway, which further contributes to apoptotic signaling

This translational inhibition represents a critical virulence mechanism that likely contributes to the pathogenicity of bat coronaviruses by reducing host antiviral protein synthesis while preserving viral protein production .

What is known about the interaction between Protein 7a and human Ap4A-hydrolase, and what are the implications for viral pathogenesis?

The interaction between Bat coronavirus Protein 7a and human Ap4A-hydrolase represents a significant host-pathogen interaction with multiple implications:

Interaction Characteristics:

  • Initially identified through yeast two-hybrid screening

  • Confirmed via co-immunoprecipitation in human cells expressing tagged versions of both proteins

  • Co-localization observed in the cytoplasm through fluorescence microscopy of cells expressing 7a-EGFP and Ap4A-hydrolase-DsRed2

Functional Implications:

  • Disruption of Ap4A Metabolism: By interacting with Ap4A-hydrolase, 7a may alter cellular levels of Ap4A (diadenosine tetraphosphate), an "allarmone" involved in stress signaling

  • Downstream Effects on Cellular Processes:

    • Cell proliferation regulation

    • DNA replication and repair pathways

    • RNA processing mechanisms

    • Apoptotic pathway modulation

  • Potential Contribution to Pathogenesis:

    • Elevated Ap4A levels (due to hydrolase inhibition) may enhance apoptotic signaling

    • Disruption of DNA repair mechanisms may increase cellular damage

    • Alteration of RNA processing could further inhibit host gene expression

This interaction represents a novel mechanism by which coronavirus accessory proteins can manipulate host cell physiology, potentially contributing to viral persistence and pathogenicity .

How do recombination events contribute to the emergence of novel bat coronaviruses containing Protein 7a?

Recombination is a fundamental evolutionary mechanism in coronaviruses, particularly significant in the emergence of novel bat coronaviruses:

Recombination Mechanisms in Bat Coronaviruses:

  • Homologous Recombination: Occurs between closely related coronaviruses during co-infection of the same host cell

  • Non-homologous Recombination: Can incorporate genetic material from distantly related viruses, as evidenced by the extreme example of P10 gene insertion from reoviruses into bat coronavirus GCCDC1

  • Hotspots for Recombination: The spike protein gene region shows particularly high recombination frequency, facilitating exchange of receptor-binding domains between viral strains

Experimental Evidence and Applications:
Researchers have demonstrated the functional significance of recombination by creating synthetic recombinant viruses such as Bat-SRBD, which combines the bat SARS-like coronavirus backbone with the SARS-CoV receptor-binding domain. This chimeric virus was shown to be infectious in cell culture and mice, and was efficiently neutralized by antibodies specific to both bat and human coronavirus spike proteins .

Research Implications:

  • Recombination events affecting Protein 7a genes could alter pathogenicity, host range, or immune evasion capabilities

  • Monitoring these events in bat populations provides critical surveillance for pandemic potential

  • Synthetic biology approaches can help predict and prepare for emerging coronavirus threats through rational design and testing of potential recombinants

This area represents a critical frontier in understanding the emergence of novel coronaviruses with pandemic potential .

How does Bat coronavirus Rp3/2004 Protein 7a compare with SARS-CoV and SARS-CoV-2 homologs?

A detailed comparative analysis reveals both conservation and divergence among coronavirus 7a proteins:

Structural Comparison:

FeatureBat-CoV Rp3/2004 7aSARS-CoV 7aSARS-CoV-2 7a
Amino Acid Length~122 aa122 aa121 aa
Domain OrganizationImmunoglobulin-like β sandwich foldImmunoglobulin-like β sandwich foldImmunoglobulin-like β sandwich fold
Transmembrane DomainPresentPresentPresent
Signal PeptidePresentPresentPresent
Sequence IdentityReferenceHigh (>80%)Moderate (~70%)

Functional Conservation:

  • Apoptosis Induction: All three proteins demonstrate pro-apoptotic activity, though with varying potency

  • Translation Inhibition: Conserved function across the proteins

  • p38 MAPK Activation: Consistent capability, potentially with different activation kinetics

  • Subcellular Localization: All localize primarily to the Golgi apparatus, with some differences in trafficking patterns

Key Divergences:

This comparative analysis highlights the evolutionary conservation of core functions in coronavirus accessory proteins while revealing adaptations that may contribute to host specificity and virulence profiles .

What techniques are most effective for studying the evolution of Protein 7a across bat coronavirus lineages?

To effectively study the evolution of Protein 7a across bat coronavirus lineages, researchers should employ a multi-disciplinary approach:

1. Phylogenetic Analysis Techniques:

  • Maximum likelihood and Bayesian inference methods with appropriate substitution models

  • Selection pressure analysis using dN/dS ratios to identify sites under positive selection

  • Ancestral sequence reconstruction to track evolutionary changes

  • Recombination detection methods to identify potential gene exchange events

2. Structural Biology Approaches:

  • X-ray crystallography of various 7a proteins from different lineages

  • Comparative structural modeling using solved structures as templates

  • Molecular dynamics simulations to assess functional impacts of sequence variations

3. Functional Comparative Studies:

  • Systematic creation of chimeric 7a proteins to map functional domains

  • Cell-based assays to compare apoptotic potential across lineages

  • Protein-protein interaction screening to identify lineage-specific host factor binding

4. Synthetic Biology and Reverse Genetics:

  • Generation of consensus sequences from different evolutionary periods

  • Creation of recombinant viruses with 7a proteins from different bat coronavirus lineages

  • Testing of synthetic constructs in appropriate cell culture and animal models

5. Field Surveillance and Sampling:

  • Targeted sequencing of 7a genes from diverse bat populations

  • Temporal sampling to track real-time evolution in natural reservoirs

  • Integration with host ecological data to identify selection pressures

This comprehensive approach allows researchers to track the evolutionary history of Protein 7a and predict potential future adaptations that might affect human health .

What are the most promising therapeutic strategies targeting Protein 7a function?

Several promising therapeutic strategies targeting coronavirus Protein 7a functions are emerging:

1. Small Molecule Inhibitors:

  • Structure-based design of compounds that bind the immunoglobulin-like fold

  • High-throughput screening for molecules that prevent 7a-induced apoptosis

  • Development of translation-enhancing compounds that counteract 7a's inhibitory effects

2. Peptide-Based Approaches:

  • Competitive inhibitors that prevent 7a interaction with Ap4A-hydrolase

  • Cell-penetrating peptides that interfere with 7a trafficking to functional sites

  • Stapled peptides designed to disrupt 7a protein-protein interactions

3. Host-Directed Therapeutics:

  • p38 MAPK pathway modulators to counteract 7a-induced stress signaling

  • Translation enhancement factors to overcome translation inhibition

  • Anti-apoptotic agents specifically targeting the pathways activated by 7a

4. Nucleic Acid-Based Strategies:

  • siRNA targeting 7a mRNA to reduce expression

  • Antisense oligonucleotides to block 7a translation

  • CRISPR-based approaches for therapeutic applications in persistent infections

Research Progress Indicators:

  • In vitro efficacy in reducing 7a-induced apoptosis

  • Cellular protection from translation shutdown

  • Reduction in viral replication and pathogenicity in animal models

  • Specificity profiles to minimize off-target effects

These approaches represent promising avenues for developing interventions against coronavirus infections, particularly those where 7a contributes significantly to pathogenesis .

How might the study of Bat coronavirus Rp3/2004 Protein 7a contribute to pandemic preparedness?

The study of Bat coronavirus Rp3/2004 Protein 7a offers significant contributions to pandemic preparedness through several mechanisms:

1. Surveillance and Risk Assessment:

  • Identification of 7a sequence variations that correlate with increased human cell compatibility

  • Development of molecular markers for enhanced virulence potential

  • Creation of databases documenting 7a evolution in bat populations

2. Diagnostic Applications:

  • Development of serological tests detecting antibodies against conserved 7a epitopes

  • Molecular diagnostic assays targeting conserved 7a gene regions

  • Point-of-care tests for rapid identification of novel coronavirus strains

3. Vaccine Development Strategies:

  • Evaluation of 7a as a potential vaccine antigen

  • Design of attenuated virus strains with modified 7a functions

  • Creation of chimeric immunogens incorporating conserved 7a epitopes

4. Predictive Modeling:

  • Use of synthetic biology approaches to test potential future recombinants

  • Experimental evolution studies to anticipate adaptation patterns

  • In silico prediction of 7a functional changes based on sequence variations

5. Pre-emptive Therapeutic Development:

  • Creation of therapeutic antibodies with broad reactivity against diverse 7a proteins

  • Development of antivirals targeting conserved 7a functions

  • Identification of host pathways consistently modulated by divergent 7a proteins

The rational design, synthesis, and recovery of hypothetical recombinant viruses can effectively investigate mechanisms of transspecies movement of zoonotic diseases and significantly enhance rapid public health responses to known or predicted emerging microbial threats .

What are the main challenges in expressing and studying authentic Bat coronavirus Rp3/2004 Protein 7a, and how can they be overcome?

Researchers face several significant challenges when working with Bat coronavirus Rp3/2004 Protein 7a:

Challenge 1: Obtaining Functional Protein

  • Issue: The 7a protein tends to aggregate when overexpressed

  • Solution:

    • Use lower induction temperatures (16-18°C) for bacterial expression

    • Employ fusion tags that enhance solubility (MBP, SUMO, or thioredoxin)

    • Optimize codon usage for expression system

    • Consider mammalian expression systems for proteins requiring authentic folding

Challenge 2: Cytotoxicity During Expression

  • Issue: 7a protein's pro-apoptotic activity complicates expression in eukaryotic systems

  • Solution:

    • Use inducible expression systems with tight regulation

    • Express protein in apoptosis-resistant cell lines

    • Utilize cell-free expression systems for initial characterization

    • Create non-toxic mutants for structural studies

Challenge 3: Achieving Authentic Post-translational Modifications

  • Issue: Bacterial systems lack appropriate machinery for mammalian-type modifications

  • Solution:

    • Express in mammalian or insect cell systems

    • Characterize modifications using mass spectrometry

    • Compare activity of proteins from different expression systems

Challenge 4: Protein-Protein Interaction Studies

  • Issue: Transient interactions may be difficult to capture

  • Solution:

    • Use chemical crosslinking to stabilize complexes

    • Employ proximity labeling techniques (BioID, APEX)

    • Develop split-reporter systems for in vivo interaction studies

    • Utilize surface plasmon resonance for kinetic measurements

Challenge 5: Structural Determination

  • Issue: Membrane association complicates structural studies

  • Solution:

    • Express soluble domains separately

    • Use appropriate detergents for full-length protein

    • Consider cryo-EM for complex structures

    • Employ NMR for dynamic studies of smaller domains

By addressing these technical challenges, researchers can more effectively study the authentic structure and function of Bat coronavirus Rp3/2004 Protein 7a .

What standardized assays should be developed to compare 7a proteins across different bat coronavirus strains?

To facilitate meaningful comparisons of 7a proteins across different bat coronavirus strains, standardization of key assays is essential:

1. Quantitative Apoptosis Assays:

  • Standardized Protocol: Time-resolved caspase-3/7 activation measurement with internal calibration standards

  • Readout: EC50 values for apoptosis induction

  • Controls: Known pro-apoptotic proteins (BAX) and anti-apoptotic compounds (Z-VAD-FMK)

  • Normalization: Account for expression levels through parallel reporter constructs

2. Translation Inhibition Measurement:

  • Standardized Protocol: Dual-luciferase reporter system with normalization controls

  • Readout: Percent inhibition of translation at defined protein concentrations

  • Controls: Known translation inhibitors (cycloheximide) at defined concentrations

  • Cell Types: Multiple relevant cell lines (human, bat, and additional reservoir species)

3. Host Protein Interaction Profiling:

  • Standardized Protocol: Affinity purification-mass spectrometry with consistent bait constructs

  • Readout: Interaction scores based on enrichment and specificity

  • Controls: Non-binding mutants and irrelevant viral proteins

  • Visualization: Interaction networks highlighting conserved and strain-specific interactions

4. p38 MAPK Activation Quantification:

  • Standardized Protocol: Phospho-specific ELISA or flow cytometry assays

  • Readout: Fold activation over baseline with time-course measurements

  • Controls: Known p38 MAPK activators and inhibitors

  • Cell Types: Primary cells relevant to infection (respiratory epithelial cells)

5. Subcellular Localization Assessment:

  • Standardized Protocol: Immunofluorescence with defined compartment markers

  • Readout: Colocalization coefficients with standard organelle markers

  • Controls: Proteins with known localization patterns

  • Analysis: Automated image analysis with consistent parameters

Data Integration Framework:

  • Central database for standardized results submission

  • Statistical methods for cross-strain comparison

  • Correlation analyses between functional parameters and sequence features

  • Machine learning approaches to predict functional properties from sequence

These standardized assays would enable systematic comparison of 7a proteins from diverse coronavirus strains, facilitating both basic understanding of viral evolution and applied research for countermeasure development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.