Recombinant Batomys granti Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Batomys granti (Luzon hairy-tailed rat) (Luzon forest rat)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELTNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAVILILIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTTDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATLTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKHFENWSASMI
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This chain, comprised of three multi-subunit complexes (succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV)), facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis via ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred via the CuA center (in subunit 2) and heme A (in subunit 1) to the binuclear center (BNC) in subunit 1. This BNC, composed of heme a3 and CuB, reduces molecular oxygen to water using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the general structure and function of Cytochrome c oxidase subunit 2 in Batomys granti?

Cytochrome c oxidase subunit 2 (MT-CO2) is a key component of the mitochondrial respiratory chain Complex IV. In Batomys granti, as in other mammals, this protein plays a crucial role in the electron transport chain and oxidative phosphorylation. MT-CO2 contains binding sites for cytochrome c and participates in the transfer of electrons from cytochrome c to the catalytic center of the enzyme . The protein contains metal centers that are essential for its electron transfer function, with specific coordination environments optimized for their roles in the enzyme complex . Unlike the heme found in hemoglobin or myoglobin, cytochrome c oxidase contains heme a, which has a farnesyl substituent replacing one vinyl group and a formyl substituent replacing one methyl group .

What expression systems are typically used for producing recombinant MT-CO2 proteins?

Recombinant MT-CO2 proteins, including those from Batomys granti, are commonly expressed in prokaryotic systems such as E. coli, similar to the approach used for Arvicanthis somalicus MT-CO2 . This expression system allows for the production of the protein with fusion tags (commonly His-tags) to facilitate purification . The recombinant protein is typically expressed as a full-length protein (1-227 amino acids) or as partial fragments depending on the research requirements . For optimal expression, codon optimization for the host organism may be necessary, especially when expressing mammalian proteins in bacterial systems.

How should researchers store and reconstitute recombinant MT-CO2 proteins?

Recombinant MT-CO2 proteins are typically supplied as lyophilized powder and should be stored at -20°C/-80°C upon receipt . Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles, which can compromise protein integrity . For reconstitution, it is recommended to briefly centrifuge the vial prior to opening to bring the contents to the bottom, then reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Adding glycerol to a final concentration of 5-50% (typically 50%) before aliquoting is recommended for long-term storage at -20°C/-80°C . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided .

What purification methods are most effective for recombinant MT-CO2?

For His-tagged recombinant MT-CO2 proteins, immobilized metal affinity chromatography (IMAC) is the preferred initial purification method. The purification process typically involves:

  • Cell lysis under native or denaturing conditions

  • Binding to Ni-NTA or similar metal affinity resin

  • Washing to remove non-specifically bound proteins

  • Elution with imidazole-containing buffer

For higher purity requirements, secondary purification steps may include:

  • Size exclusion chromatography to separate based on molecular size

  • Ion exchange chromatography to separate based on charge differences

  • Affinity chromatography using specific ligands

The purification strategy should aim to achieve greater than 90% purity as determined by SDS-PAGE .

How can researchers verify the correct folding and functional activity of recombinant MT-CO2?

Verifying correct folding and functional activity of recombinant MT-CO2 requires multiple complementary approaches:

  • Spectroscopic analysis: Cytochrome c oxidase has characteristic absorption spectra in both oxidized and reduced states . The oxidized form contains Cu and Fe centers with specific spectral signatures . Comparing the spectra of recombinant protein with native enzyme can indicate proper metal incorporation and folding.

  • Ligand binding assays: Cytochrome c oxidase binds specific ligands. For example, cytochrome a3 binds cyanide in the Fe(III) form and carbon monoxide in the Fe(II) form . Testing these binding properties can verify functional conformation.

  • Electron transfer activity: Measuring the protein's ability to transfer electrons from cytochrome c to oxygen using spectrophotometric assays that monitor cytochrome c oxidation.

  • Membrane reconstitution experiments: For full functional assessment, incorporation into liposomes or nanodiscs to recreate the membrane environment may be necessary.

What are the challenges in expressing mitochondrially-encoded proteins like MT-CO2 in heterologous systems?

Expressing mitochondrially-encoded proteins like MT-CO2 in heterologous systems presents several significant challenges:

  • Genetic code differences: Mitochondrial DNA uses a slightly different genetic code compared to nuclear DNA, which can lead to mistranslation in heterologous expression systems .

  • Membrane protein assembly: MT-CO2 is normally assembled in the inner mitochondrial membrane with specific chaperones and assembly factors. Heterologous expression may lack these factors, leading to improper folding or assembly .

  • Post-translational modifications: Mitochondrial proteins often undergo specific post-translational modifications that may not occur correctly in heterologous systems.

  • Codon usage bias: Mitochondrial genes have different codon usage preferences compared to nuclear genes, potentially reducing expression efficiency .

  • Toxicity: Overexpression of membrane proteins can be toxic to host cells.

Research on allotopic expression (expressing mitochondrial genes from the nucleus) in yeast has shown that even with optimized sequences, efficiency is limited compared to natural mitochondrial expression . For example, cytosol-synthesized Cox2 with the W56R mutation (cCox2W56R) in yeast can restore respiratory function in a Δcox2 strain, but results in only ~60% steady-state accumulation of cytochrome c oxidase compared to wild-type levels .

How can researchers differentiate between naturally occurring sequence variants and pathogenic mutations in MT-CO2 genes?

Differentiating between benign sequence variants and pathogenic mutations in MT-CO2 genes requires a multi-faceted approach:

  • Segregation studies: Analyzing the co-inheritance of the variant with disease phenotypes in families. In mitochondrial genes, this is complicated by heteroplasmy (varying proportions of mutant and wild-type mtDNA) .

  • Single fiber segregation: In cases with heteroplasmic variants, analyzing individual muscle fibers showing cytochrome c oxidase deficiency versus normal fibers can determine if the variant segregates with the biochemical defect .

  • Conservation analysis: Assessing evolutionary conservation of the affected amino acid across species. Highly conserved residues are more likely to be functionally important.

  • Structural analysis: Predicting the effect of the amino acid change on protein structure and function.

  • Functional studies: Measuring the impact of the variant on enzyme activity, assembly, or stability.

A specific example from search result described a case where two heteroplasmic MT-CO2 variants (m.7887G>A and m.8250G>A) were identified in a patient with cerebellar ataxia and neuropathy. Through comprehensive analysis including single fiber segregation studies and family studies (including biopsy of the clinically-unaffected mother), researchers determined that only the novel m.7887G>A p.(Gly101Asp) variant fulfilled the criteria necessary to prove causality of the patient's clinical phenotype .

What experimental approaches can be used to study the interaction between MT-CO2 and cytochrome c?

Studying the interaction between MT-CO2 and cytochrome c requires specialized techniques to analyze protein-protein interactions, particularly for membrane proteins:

  • Co-immunoprecipitation: Using antibodies against MT-CO2 or cytochrome c to pull down interaction complexes.

  • Surface plasmon resonance (SPR): Measuring binding kinetics and affinities between purified proteins.

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry to identify interaction interfaces.

  • Mutagenesis: Systematic mutation of residues in the predicted interaction interface to identify key contact points.

  • Cryo-electron microscopy: Structural determination of the complex to visualize interaction details.

  • Molecular dynamics simulations: Computational modeling of the interaction.

  • FRET (Förster Resonance Energy Transfer): To detect proximity between labeled proteins in reconstituted systems.

These approaches can be complemented by functional assays measuring electron transfer rates to correlate structural findings with functional consequences.

How should researchers design experiments to compare wild-type and mutant MT-CO2 variants?

When comparing wild-type and mutant MT-CO2 variants, researchers should implement a comprehensive experimental design that controls for variables and enables thorough analysis:

Experimental ParameterRecommendation
Expression systemUse identical systems (same vector, host strain, culture conditions) for both variants
Protein quantificationEmploy multiple methods (Bradford/BCA assay, SDS-PAGE densitometry) to ensure equal loading
Purification procedureApply identical protocols with the same buffer compositions
Storage conditionsMaintain both variants under identical conditions after purification
Activity measurementsPerform under multiple substrate concentrations to derive kinetic parameters
ReplicationInclude biological replicates (≥3) and technical replicates
ControlsInclude positive controls (known active proteins) and negative controls

For functional comparisons, researchers should assess:

  • Enzyme kinetics (K₍m₎, V₍max₎, k₍cat₎)

  • Protein stability under various conditions (temperature, pH)

  • Assembly efficiency into the cytochrome c oxidase complex

  • Interaction with partner proteins

  • Spectroscopic properties reflecting the metal center environment

When analyzing potentially pathogenic variants, researchers should consider heteroplasmy levels across different tissues and implement single-fiber segregation studies to correlate biochemical defects with variant load .

What controls and validation steps are essential when working with recombinant MT-CO2 in experimental systems?

Essential controls and validation steps when working with recombinant MT-CO2 include:

  • Sequence verification: Confirming the correct sequence through DNA sequencing of the expression construct.

  • Protein identity validation: Using Western blotting with specific antibodies and/or mass spectrometry to confirm the identity of the purified protein.

  • Purity assessment: SDS-PAGE analysis to ensure purity greater than 90% .

  • Functional controls:

    • Positive control: Native cytochrome c oxidase or well-characterized recombinant variant

    • Negative control: Heat-denatured enzyme or variant with known inactivating mutation

  • Metal content analysis: Verifying the incorporation of metal cofactors using atomic absorption spectroscopy or inductively coupled plasma mass spectrometry.

  • Homogeneity assessment: Size exclusion chromatography to confirm the absence of aggregates.

  • Endotoxin testing: Particularly important for proteins intended for cell culture experiments.

  • Activity baseline: Establishing reproducible baseline activity measurements with standardized substrates and conditions.

How can researchers accurately measure the enzymatic activity of recombinant MT-CO2 within the cytochrome c oxidase complex?

Measuring the enzymatic activity of recombinant MT-CO2 within the cytochrome c oxidase complex requires specialized techniques:

  • Oxygen consumption assays:

    • Clark-type oxygen electrode measurements

    • Optical oxygen sensors for high-throughput applications

  • Spectrophotometric assays:

    • Monitoring the oxidation of reduced cytochrome c at 550 nm

    • Following the absorbance changes of the enzyme's metal centers

  • Reconstitution systems:

    • Incorporation into liposomes or nanodiscs to create a membrane environment

    • Co-expression or in vitro assembly with other subunits of the complex

  • Activity coupling assays:

    • Linking enzyme activity to fluorescent or luminescent reporters

  • Membrane potential measurements:

    • Using voltage-sensitive dyes in reconstituted systems

    • Electrode-based measurements of proton pumping activity

Each measurement should be calibrated against known standards and include controls for non-enzymatic rates. Assays should be performed under various substrate concentrations to derive kinetic parameters such as K₍m₎ and V₍max₎.

What analytical techniques are most informative for characterizing the structural properties of Batomys granti MT-CO2?

Characterizing the structural properties of Batomys granti MT-CO2 requires a combination of biophysical and biochemical techniques:

  • Spectroscopic methods:

    • Circular dichroism (CD) spectroscopy for secondary structure analysis

    • Fluorescence spectroscopy to probe tertiary structure and conformational changes

    • Absorption spectroscopy to characterize the metal centers and their coordination environment

  • Structural determination techniques:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for high-resolution structural analysis

    • NMR spectroscopy for dynamic regions

  • Mass spectrometry:

    • Native MS for quaternary structure analysis

    • Hydrogen-deuterium exchange MS for conformational dynamics

    • Cross-linking MS for interaction interfaces

  • Bioinformatic analysis:

    • Homology modeling based on related structures

    • Molecular dynamics simulations

    • Sequence conservation analysis across species

  • Functional probes:

    • Chemical modifications of specific residues

    • Site-directed mutagenesis to test structural predictions

    • Limited proteolysis to identify flexible regions

These techniques can provide complementary information about the protein's structure-function relationship, particularly regarding its metal coordination centers and interaction interfaces.

How can recombinant MT-CO2 be used to study mitochondrial diseases associated with cytochrome c oxidase deficiency?

Recombinant MT-CO2 serves as a valuable tool for studying mitochondrial diseases associated with cytochrome c oxidase deficiency through multiple research applications:

  • Structure-function analysis: Introducing patient-derived mutations into recombinant MT-CO2 allows researchers to study how specific amino acid changes affect protein folding, stability, and function .

  • Biochemical characterization: Purified mutant proteins can be used for detailed biochemical and biophysical studies to determine how mutations impact enzymatic activity, protein stability, and assembly into the cytochrome c oxidase complex .

  • Drug screening platforms: Recombinant proteins carrying disease-associated mutations can serve as targets for high-throughput screening of potential therapeutic compounds.

  • Genetic rescue experiments: Allotopic expression studies can test whether nuclear-encoded, mitochondrially-targeted MT-CO2 variants can rescue cellular defects in patient-derived cells .

  • Pathogenic variant classification: By testing variants of uncertain significance, researchers can establish whether specific mutations are likely to be pathogenic, providing valuable information for genetic counseling and diagnosis .

The study of novel MT-CO2 variants, such as the m.7887G>A p.(Gly101Asp) mutation associated with cerebellar ataxia and neuropathy, illustrates how detailed biochemical and genetic analysis can elucidate the pathogenic mechanisms of mitochondrial disease .

What evolutionary insights can be gained from comparing MT-CO2 sequences across different species?

Comparative analysis of MT-CO2 sequences across species provides valuable evolutionary insights:

  • Phylogenetic relationships: MT-CO2 sequences can be used to construct phylogenetic trees, helping to clarify evolutionary relationships between species. For example, mitochondrial cytochrome c oxidase genes have been used to analyze evolutionary relationships in pinworms from humans and chimpanzees .

  • Evolutionary rate determination: By comparing the rate of sequence divergence in MT-CO2 across species, researchers can identify regions under different selective pressures. The CO1 gene has shown considerable divergence correlating with human evolution in studies of human pinworms .

  • Functional constraint mapping: Regions of high sequence conservation typically indicate functionally critical domains. In cytochrome c oxidase, metal-binding sites and substrate interaction regions show higher conservation .

  • Adaptation signatures: Species-specific adaptations in MT-CO2 may reflect metabolic adaptations to different environmental niches or physiological demands.

  • Co-evolution patterns: Comparing MT-CO2 evolution with other mitochondrial and nuclear-encoded subunits can reveal co-evolutionary patterns essential for maintaining protein-protein interactions within the enzyme complex.

These comparative analyses contribute to our understanding of mitochondrial gene evolution and help identify functionally important regions that could be relevant for interpreting the impact of mutations in human disease.

What insights can be gained from studying the post-translational modifications of MT-CO2 in different species?

Post-translational modifications (PTMs) of MT-CO2 vary across species and provide important insights into protein function and regulation:

  • Species-specific processing: Different organisms process MT-CO2 in unique ways. For example, in Bacillus subtilis, subunit II of cytochrome c oxidase (CtaC) is a lipoprotein that undergoes specific lipid modifications essential for enzyme activity .

  • Signal peptide processing: The removal of signal peptides from MT-CO2 can be critical for function. Studies in B. subtilis show that while lipid modification is not essential for heme binding, removal of the signal peptide is required for formation of functional enzyme .

  • Membrane integration: PTMs can affect how MT-CO2 integrates into membranes. In B. subtilis, mutants blocked in prolipoprotein diacylglyceryl transferase (Lgt) or signal peptidase type II (Lsp) are deficient in cytochrome caa3 enzyme activity, highlighting the importance of proper processing .

  • Heme attachment: In some organisms, heme groups are covalently attached to cytochrome c domains. The covalent binding of heme to the cytochrome c domain in B. subtilis CtaC is not dependent on processing at the N-terminal part of the protein .

  • Regulatory modifications: PTMs may regulate enzyme activity in response to metabolic conditions or oxidative stress.

Studying these modifications across species provides insights into the evolution of enzyme regulation and can inform approaches to expressing functional recombinant proteins for research and therapeutic applications.

How might recombinant MT-CO2 be utilized in developing therapeutic approaches for mitochondrial disorders?

Recombinant MT-CO2 offers several potential applications in developing therapeutic approaches for mitochondrial disorders:

  • Allotopic expression therapy: Research on allotopic expression of mitochondrial genes provides proof of principle that nuclear-encoded, mitochondrially-targeted versions of MT-CO2 could potentially complement mitochondrial gene defects . Studies in yeast have demonstrated that cytosol-synthesized Cox2 with the W56R mutation can restore respiratory growth in strains lacking the mitochondrial gene .

  • Drug development platforms: Recombinant MT-CO2 proteins containing disease-associated mutations can serve as targets for screening small molecules that might stabilize the mutant protein or enhance its assembly into functional complexes.

  • Gene therapy vector optimization: Understanding the structural and functional properties of MT-CO2 can inform the design of optimized gene therapy vectors for allotopic expression, addressing challenges such as protein import, processing, and assembly.

  • Protein replacement therapy: While technically challenging, purified recombinant MT-CO2 could potentially be developed for direct protein replacement therapies using appropriate delivery systems that target mitochondria.

  • Biomarker development: Recombinant MT-CO2 can be used to develop and validate antibodies and other detection methods for biomarker studies in mitochondrial disorders.

The successful allotopic expression of Cox2 in yeast demonstrates that with proper optimization, it may be possible to develop gene therapy approaches for human mitochondrial diseases caused by MT-CO2 mutations . These results are particularly relevant to developing a rational design of genes for allotopic expression intended to treat human mitochondrial diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.