Recombinant Batrachocottus multiradiatus Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Batrachocottus multiradiatus Rhodopsin (rho)

Recombinant Batrachocottus multiradiatus rhodopsin (rho) is a full-length photoreceptor protein expressed in E. coli and engineered for research and therapeutic applications. It is derived from the Baikal sculpin (Batrachocottus multiradiatus), a freshwater fish species, and shares structural and functional homology with human rhodopsin. The protein is critical for studying retinal diseases, such as retinitis pigmentosa (RP), and serves as a model for understanding G-protein-coupled receptor (GPCR) signaling and chromophore interactions .

Functional Domains

The protein retains key functional regions:

  • Chromophore-binding pocket: Critical for 11-cis-retinal or 3-dehydroretinal interaction, enabling light-induced conformational changes .

  • G-protein interaction sites: Required for signal transduction via transducin activation .

  • Disulfide bonds: Native Cys-110–Cys-187 bond conserved in GPCRs, with mutations (e.g., Cys-185–Cys-187) linked to misfolding in RP .

Role in Retinal Disease Studies

Rhodopsin mutations are the leading cause of autosomal dominant RP. The recombinant protein is used to:

  1. Model misfolding mechanisms: Mutations in transmembrane or intradiscal domains disrupt retinal binding, triggering ER retention and photoreceptor apoptosis .

  2. Test therapeutic interventions:

    • RNA-based therapies: Ribozyme-mediated correction of mutant RHO mRNA (e.g., RZ-004) targets conserved regions upstream of mutations .

    • Gene silencing: Antisense oligonucleotides (ASOs) reduce mutant rhodopsin expression by 70%, delaying retinal degeneration in preclinical models .

Energy Metabolism and Toxicity

Overexpression of wild-type or mutant rhodopsin (e.g., P23H, R135L) in photoreceptor cells induces oxidative phosphorylation (OXPHOS) deficits and mitochondrial loss. Mutants like R135L and G188R exacerbate energy failure by impairing glycolytic compensation .

Clinical Trials and Gene Therapy

RZ-004, an AAV-delivered ribozyme, reprograms mutant RHO mRNA into wild-type mRNA by targeting conserved upstream regions. This approach addresses diverse mutations with a single therapy .

TherapyMechanismStatusTarget MutationSource
RZ-004Trans-splicing ribozymePhase 1/2aAutosomal dominant RHO
AAV-RS301RNA interferencePreclinicalP23H
ASOsRNAse H-mediated degradationPreclinicalMultiple

Challenges in Protein Overexpression

Overexpression of rhodopsin, even wild-type, causes energy stress and apoptosis in rod cells. This highlights the need for precise expression control in gene therapies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which you may use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
rho; Rhodopsin; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Batrachocottus multiradiatus (Baikal sculpin) (Batrachocottus nikolskii multiradiatus)
Target Names
rho
Target Protein Sequence
YLVSPAAYAALGAYMFLLILIGFPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLG GFTTTMYTSMHGYFVLGRLGCNLEGFFATLGGEIALWSLVVLAIERWIVVCKPISNFRFT EDNAIMGLAFSWVMALTCAVPPLVGWSRYIPEGMQCSCGVDYYTRAEGFNNESFVIYMFI VHFPIPLSVIFFCYGRLLCAVKEAAAAQQESETTQRAEKEVSRMVVILVIGFLVCWLPYA SVAWWIFCNQGSDFGPIFMTLPSFFAKRPAIYNPMIYICMNKQFRHCMI
Uniprot No.

Target Background

Function
Rhodopsin, a photoreceptor, is crucial for image-forming vision under low light conditions. While most saltwater fish species utilize retinal as their chromophore, most freshwater fish utilize 3-dehydroretinal, or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates the displacement of the bound G-protein alpha subunit by arrestin, thereby terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Batrachocottus multiradiatus Rhodopsin and why is it significant for research?

Batrachocottus multiradiatus rhodopsin is a visual pigment protein found in the Baikal sculpin, a member of the cottoid fish group endemic to Lake Baikal in Siberia. This rhodopsin belongs to the Type II rhodopsin family that functions as photoactivated G-protein coupled receptors (GPCRs) in animal vision . Its significance for research stems from the unique evolutionary adaptations of cottoid fish visual systems to the varying light conditions in Lake Baikal. The visual pigments of these fish exhibit short-wave shifted maximum absorption wavelengths (λmax) that correlate with increasing depth of habitat . This makes B. multiradiatus rhodopsin an excellent model for studying spectral tuning mechanisms and the molecular basis of visual adaptation to specific environmental conditions.

How does recombinant Batrachocottus multiradiatus Rhodopsin differ from native rhodopsin?

Recombinant Batrachocottus multiradiatus rhodopsin is produced in a heterologous expression system (typically E. coli) and often includes affinity tags (such as His-tag) to facilitate purification . The commercially available recombinant protein features an N-terminal His tag . While the core functional properties should remain similar to the native protein, the following differences might exist:

  • Post-translational modifications may differ between prokaryotic expression systems and native eukaryotic cells

  • The presence of affinity tags may slightly alter protein folding or stability

  • The recombinant protein is typically produced in a denatured or unfolded state and requires proper reconstitution with 11-cis retinal to form a functional pigment

  • The lipid environment differs from the native membrane environment

These differences should be considered when designing experiments, particularly those focused on subtle structural or functional properties .

What are the optimal conditions for reconstituting functional Batrachocottus multiradiatus Rhodopsin with 11-cis retinal?

Reconstitution of functional rhodopsin requires careful attention to experimental conditions. Based on established protocols for rhodopsin reconstitution:

  • Preparation of recombinant protein:

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% for long-term storage stability

    • Avoid repeated freeze-thaw cycles

  • 11-cis retinal preparation:

    • 11-cis retinal must be handled under dim red light conditions to prevent isomerization

    • The absorption spectrum of pure 11-cis retinal should show a characteristic peak at approximately 380 nm

  • Reconstitution process:

    • Mix the opsin with 11-cis retinal in appropriate buffer (typically PBS-based)

    • Allow sufficient time for Schiff base formation (typically 1-4 hours at room temperature in darkness)

    • Verify successful reconstitution by spectrophotometric analysis, with functional rhodopsin showing a characteristic absorption maximum at approximately 500 nm (the exact λmax may vary slightly depending on specific amino acid composition)

The success of reconstitution can be confirmed by measuring the dark spectrum, followed by light exposure to trigger photobleaching, and calculating the difference spectrum .

What amino acid positions are critical for spectral tuning in Batrachocottus multiradiatus Rhodopsin?

Research on cottoid fish rhodopsins has identified several key amino acid positions that contribute to spectral tuning. Based on studies of blue opsin genes in Lake Baikal cottoid fish, three potential spectral tuning sites have been identified at positions 118, 215, and 269 . Site-directed mutagenesis experiments followed by spectrophotometric analysis of the mutant opsins have confirmed the functional importance of these sites.

PositionWild-type residueMutant residueEffect on λmaxReference
118ThreonineGlycineBlue-shift
215ProlineGlycineBlue-shift
269VariousVariousVariable

Additionally, comparative studies with other vertebrate rhodopsins have identified positions 83 and 292 as potentially important for adaptation to dim-light environments. For example, the D83N substitution is associated with increased stability of the active Meta-II state, potentially increasing photosensitivity, while A292S has been found to result in spectral shifts toward shorter wavelengths .

How can I design experiments to investigate the photochemical cycle of Batrachocottus multiradiatus Rhodopsin?

Investigating the photochemical cycle of B. multiradiatus rhodopsin requires a combination of spectroscopic and biochemical techniques:

  • Time-resolved spectroscopy:

    • Flash photolysis to monitor the formation and decay of photointermediates

    • Measure the rate of Meta-II formation, which provides insights into activation kinetics

    • Determine the rate of all-trans retinal release, which reflects Meta-II stability

  • G-protein activation assays:

    • Measure the efficiency of G-protein (transducin) activation using GTPγS binding assays

    • Compare activation rates with other rhodopsins to identify functional specializations

  • Site-directed mutagenesis approach:

    • Create point mutations at key residues (e.g., positions 118, 215, 269)

    • Express mutant proteins in a suitable system (e.g., 293T cells)

    • Reconstitute with 11-cis retinal and characterize spectral and kinetic properties

    • Analyze dark, photobleached, and difference spectra to determine λmax values and other photochemical properties

  • Structural analysis:

    • Create 2D and 3D models of the rhodopsin structure to predict and interpret the effects of amino acid substitutions

    • Use these models to identify potential hydrogen bonding networks or other interactions that might influence spectral tuning

How does the absorption spectrum of Batrachocottus multiradiatus Rhodopsin compare to other cottoid fish rhodopsins?

Cottoid fish from Lake Baikal demonstrate a clear correlation between their habitat depth and the spectral properties of their visual pigments. Studies have shown that their visual pigments exhibit short-wave shifted λmax values with increasing depth of habitat . While specific spectral data for Batrachocottus multiradiatus is not explicitly provided in the search results, the patterns observed among the cottoid fish of Lake Baikal suggest that:

  • Shallow-water species typically have rhodopsins with λmax values closer to 500-505 nm

  • Deep-water species show blue-shifted absorption maxima, potentially in the 480-495 nm range

This spectral tuning represents an adaptation to the available light spectrum at different depths in Lake Baikal, where shorter wavelengths penetrate deeper than longer wavelengths. Comparative studies with other rhodopsins show that typical vertebrate rhodopsins have λmax values around 500 nm (e.g., bovine rhodopsin: 499 nm, chicken rhodopsin: 503 nm) .

What evolutionary insights can be gained from studying Batrachocottus multiradiatus Rhodopsin?

Batrachocottus multiradiatus rhodopsin provides valuable insights into the evolutionary processes that shape visual systems:

  • Adaptive radiation: The cottoid fish of Lake Baikal represent a species flock that has undergone adaptive radiation, with visual pigments showing adaptation to different light environments . This makes them excellent models for studying the molecular basis of adaptation.

  • Convergent vs. homologous evolution: The study of rhodopsins addresses fundamental questions about convergent evolution. While Type I and Type II rhodopsins have been considered examples of convergent evolution due to lack of sequence similarity despite shared structural features, experimental evidence challenges this view by demonstrating that the rhodopsin fold is not strictly required for photosensitive activity .

  • Molecular phylogenetics: Phylogenetic analysis of blue opsin sequences from cottoid fish provides insights into the evolutionary history of these visual pigments and their relationship to speciation events in Lake Baikal .

  • Natural selection on visual systems: The correlation between spectral properties and habitat depth demonstrates how natural selection can fine-tune molecular function through specific amino acid substitutions, providing a clear example of molecular adaptation .

How do the spectral tuning mechanisms in Batrachocottus rhodopsin compare to those in other vertebrate visual pigments?

The spectral tuning mechanisms in Batrachocottus and other cottoid fish rhodopsins share commonalities with other vertebrate visual pigments but also display unique features:

  • Shared tuning sites: Some of the key spectral tuning sites identified in cottoid fish rhodopsins, such as positions 83 and 292, are also important in other vertebrate lineages. For example, the D83N substitution is found in various dim-light adapted organisms including deep-sea fishes, marine mammals, and bats, often occurring together with A292S .

  • Lineage-specific patterns: While A292S typically co-occurs with N83 in teleost fish and mammals and causes large blue-shifts in absorption spectra, all currently available bird RH1 sequences, including bowerbirds, have A292 despite having N83 . This suggests lineage-specific constraints or alternative compensatory mechanisms.

  • Functional consequences beyond spectral tuning: Some substitutions affect multiple aspects of rhodopsin function. For instance, N83 not only influences spectral sensitivity but also enhances the stability of the active Meta-II state, potentially increasing photosensitivity in dim-light environments .

Organism groupKey spectral tuning sitesTypical adaptationReference
Cottoid fish118, 215, 269Depth-dependent blue-shift
Deep-sea fish83, 292Extreme blue-shift
Bats83, 292Increased sensitivity
Birds83 (but not 292)Variable adaptation

What are the recommended methods for expression and purification of recombinant Batrachocottus multiradiatus Rhodopsin?

Based on established protocols for rhodopsin expression and the specific information about the commercially available recombinant protein:

  • Expression system:

    • E. coli is commonly used for recombinant rhodopsin expression

    • Mammalian expression systems (e.g., 293T cells) may provide more native-like post-translational modifications and folding

  • Construct design:

    • Include an N-terminal His-tag for affinity purification

    • Consider a full-length construct (amino acids 1-289) to maintain native structure and function

  • Purification strategy:

    • Metal affinity chromatography for His-tagged protein

    • Consider detergent selection carefully as it affects protein stability and function

    • Purity should exceed 90% as determined by SDS-PAGE

  • Verification methods:

    • Western blotting to confirm expression and assess protein levels

    • SDS-PAGE to evaluate purity

    • Spectroscopic analysis after reconstitution with 11-cis retinal to confirm functional integrity

  • Storage conditions:

    • Store at -20°C/-80°C

    • Lyophilized powder or in buffer containing 6% trehalose, pH 8.0

    • Add 5-50% glycerol for long-term storage

    • Avoid repeated freeze-thaw cycles

How can I use site-directed mutagenesis to investigate structure-function relationships in Batrachocottus multiradiatus Rhodopsin?

Site-directed mutagenesis is a powerful approach for investigating structure-function relationships in rhodopsins. Based on the methods described in the search results:

  • Selection of mutagenesis targets:

    • Identify conserved or variable sites based on sequence alignments of cottoid fish rhodopsins

    • Focus on sites implicated in spectral tuning (e.g., positions 118, 215, 269)

    • Consider sites known to affect other functional properties in related rhodopsins (e.g., 83, 292)

  • Mutagenesis methods:

    • Use established methods such as the Promega Altered Sites® II system or Stratagene QuikChange™

    • Design mutagenic oligonucleotides with appropriate melting temperatures and specificity

    • Verify mutations by DNA sequencing before proceeding to expression

  • Expression of mutant opsins:

    • Express wild-type and mutant rhodopsins in a suitable system (e.g., 293T cells)

    • Harvest cells and prepare membranes containing the expressed opsins

    • Verify expression levels by Western blotting to ensure comparable protein amounts for functional comparisons

  • Functional characterization:

    • Reconstitute wild-type and mutant opsins with 11-cis retinal

    • Record absorption spectra before and after photobleaching

    • Calculate difference spectra to determine λmax values

    • Analyze kinetic parameters such as Meta-II formation rates or retinal release rates

  • Structural interpretation:

    • Use 2D and 3D structural models to interpret the functional effects of mutations

    • Consider both direct and indirect effects of amino acid substitutions on chromophore-protein interactions

What are the challenges in studying the photochemical properties of Batrachocottus multiradiatus Rhodopsin?

Studying the photochemical properties of B. multiradiatus rhodopsin presents several challenges:

  • Chromophore stability and handling:

    • 11-cis retinal is light-sensitive and prone to isomerization

    • All procedures involving retinal and reconstituted rhodopsin must be performed under dim red light conditions

    • Careful spectroscopic verification of retinal purity is essential

  • Protein stability issues:

    • Membrane proteins are inherently challenging to work with

    • Detergent selection critically affects protein stability and function

    • Repeated freeze-thaw cycles should be avoided

  • Expression and purification challenges:

    • Achieving sufficient expression levels for detailed biophysical studies can be difficult

    • Maintaining protein functionality throughout purification requires careful optimization

    • Western blotting should be used to verify expression and assess protein levels

  • Spectroscopic analysis limitations:

    • Low signal-to-noise ratios in spectroscopic measurements can complicate data interpretation

    • Multiple scans may be necessary, followed by data smoothing to obtain reliable spectra

    • Both raw and smoothed data should be analyzed to avoid artifacts

  • Kinetic measurements:

    • Time-resolved measurements require specialized equipment and careful experimental design

    • Temperature control is critical for consistent kinetic measurements

    • Comparative analysis with well-characterized rhodopsins (e.g., bovine) is recommended as an internal control

What are the future research directions for Batrachocottus multiradiatus Rhodopsin?

Future research on Batrachocottus multiradiatus rhodopsin could explore several promising directions:

  • Comprehensive spectral tuning map: Systematic mutagenesis studies to identify all residues contributing to the unique spectral properties of B. multiradiatus rhodopsin could provide a complete understanding of the molecular basis of spectral tuning in this system.

  • Comparative analysis across depth gradients: Detailed comparison of rhodopsins from cottoid fish species living at different depths in Lake Baikal could reveal additional adaptations to specific light environments and provide insights into the evolutionary processes driving visual adaptation .

  • Integration with ecological and behavioral studies: Connecting the molecular properties of B. multiradiatus rhodopsin with the ecological niche and visual behavior of the species could provide a more comprehensive understanding of the adaptive significance of specific rhodopsin properties.

  • Application in optogenetics: The unique properties of B. multiradiatus rhodopsin might make it valuable for optogenetic applications, potentially offering spectral or kinetic advantages over currently used rhodopsins.

  • Evolutionary studies using ancestral sequence reconstruction: Reconstructing ancestral rhodopsin sequences for the cottoid fish radiation could provide insights into the evolutionary trajectory of visual adaptation in Lake Baikal .

These research directions highlight the continued value of studying B. multiradiatus rhodopsin as a model system for understanding the molecular basis of visual adaptation and the evolution of photosensitive proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.