Recombinant Batrachocottus nicolskii Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Functional Overview

Rhodopsins are photopigments critical for light detection in retinal photoreceptor cells. While Batrachocottus nicolskii rhodopsin’s specific physiological role is not documented, its recombinant form serves as a model for studying:

  • Phototransduction mechanisms: Involving retinal isomerization, G-protein activation, and signal amplification .

  • Protein stability and folding: Mutations in N-terminal domains (e.g., T4K, P23H) often disrupt rhodopsin folding, leading to retinal degeneration .

Applications in Research

This recombinant protein is primarily used in:

  1. Structural Biology:

    • Crystallization studies to elucidate 7TM domain interactions and retinal-binding dynamics .

    • Comparative studies with human rhodopsin mutants (e.g., P23H, G90V) to understand disease mechanisms .

  2. Immunological Assays:

    • ELISA kits for detecting rhodopsin-specific antibodies or quantifying protein levels .

  3. Protein Engineering:

    • Testing pharmacological chaperones (e.g., 9-cis-retinal, YC-001) to rescue folding defects in rhodopsin mutants .

Research Findings and Limitations

While direct studies on Batrachocottus nicolskii rhodopsin are sparse, insights from related rhodopsins highlight its potential utility:

  • Stability Challenges: Mutations in the N-terminal cap (e.g., T17M, P23H) compromise rhodopsin stability, as shown in human and rodent models .

  • Therapeutic Strategies: RNA-targeted therapies (e.g., trans-splicing ribozymes) to correct rhodopsin mutations are under development .

ApplicationKey InsightSource
Pharmacological Rescue9-cis-retinal stabilizes misfolded rhodopsin mutants (e.g., P23H) .
Gene TherapyAAV-delivered ribozymes suppress mutant mRNA while delivering wild-type RHO .

Product Specs

Form
Supplied as a lyophilized powder.
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request; additional charges will apply. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
rho; Rhodopsin; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Batrachocottus nikolskii (Fat sculpin) (Cottus nikolskii)
Target Names
rho
Target Protein Sequence
YLVSPAAYAALGAYMFLLILIGFPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLG GFTTTMYTSMHGYFVLGRLGCNLEGFFATLGGEIALWSLVVLAIERWIVVCKPISKFRFT EDNAIMGLAFSWVMALACAVPPLVGWLRYIPEGMQCTCGVDYYTRAEGFDNESFVIYMFI VHFLIPLSVIFFCYGRLLCAVKEAAAAQQESETTQRAEKEVSRMVVIMVIGFLVCWLPYA SVAWWIFCNQGSDFGPIFMTLPSFFAKRPAIYNPMIYICMNKQFRHCMI
Uniprot No.

Target Background

Function

Photoreceptor essential for low-light vision. While most marine fish utilize retinal as a chromophore, freshwater species often use 3-dehydroretinal, or a combination of both. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating signaling via G-proteins. Subsequent receptor phosphorylation, mediated by arrestin, displaces the bound G-protein alpha subunit, terminating signaling.

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Batrachocottus nicolskii Rhodopsin and why is it significant for research?

Batrachocottus nicolskii Rhodopsin (rho) is a visual pigment protein from the Fat sculpin fish native to Lake Baikal in Eastern Siberia. It belongs to the class of G-protein coupled receptors (GPCRs) with seven transmembrane α-helices. This rhodopsin is significant because cottoid fish from Lake Baikal have evolved visual pigments with shifted wavelengths of maximum absorption (λmax) correlating with their habitat depth, making them excellent models for studying evolutionary adaptation of vision to specific environments . The recombinant form allows researchers to examine the molecular determinants of spectral tuning and photochemical properties in a controlled experimental setting.

How does Batrachocottus nicolskii Rhodopsin compare to other visual pigments?

Batrachocottus nicolskii Rhodopsin shares the fundamental GPCR fold with other rhodopsins but exhibits specific adaptations related to its aquatic environment. Like other visual pigments from Lake Baikal cottoid fish, it shows spectral tuning adaptations that shift its λmax in correlation with habitat depth . While it shares the basic seven-transmembrane structure with both type I (microbial) and type II (animal) rhodopsins, it belongs to the type II category that functions as a photoactivated GPCR in animal vision .

How can recombinant Batrachocottus nicolskii Rhodopsin be used to investigate spectral tuning mechanisms?

Investigations of spectral tuning using Batrachocottus nicolskii Rhodopsin involve several methodological approaches:

  • Site-directed mutagenesis: By generating mutations at the identified spectral tuning sites (positions 118, 215, and 269), researchers can assess their contributions to the wavelength of maximum absorption. This approach involves:

    • PCR-based mutagenesis to introduce specific amino acid substitutions

    • Expression of mutant proteins in heterologous systems (e.g., 293T cells)

    • Reconstitution with 11-cis retinal

    • Spectrophotometric analysis to determine λmax shifts

  • Comparative analysis: By comparing the spectral properties of Batrachocottus nicolskii Rhodopsin with those of related species from different depths in Lake Baikal, researchers can correlate specific amino acid variations with environmental adaptations.

  • Structural modeling: Using the amino acid sequence, researchers can generate 2D and 3D structural models to predict how specific residues might interact with the retinal chromophore and influence spectral properties .

These approaches provide insights into the molecular basis of visual adaptation in aquatic environments and contribute to our understanding of protein-chromophore interactions in photosensitive systems.

What role does recombinant Batrachocottus nicolskii Rhodopsin play in evolutionary studies?

Recombinant Batrachocottus nicolskii Rhodopsin serves as a valuable tool for investigating several aspects of molecular evolution:

Research methodology typically includes:

  • DNA sequence analysis and phylogenetic tree construction

  • Ancestral state reconstruction

  • Correlation of molecular changes with ecological parameters

  • Functional characterization of ancestral and intermediate variants

How can deep mutational scanning be applied to study Batrachocottus nicolskii Rhodopsin variants?

Deep mutational scanning (DMS) provides a powerful approach to comprehensively characterize the functional effects of mutations in Batrachocottus nicolskii Rhodopsin:

  • Library construction: Generate a pooled genetic library containing systematic mutations across the rhodopsin gene, with each variant linked to a unique molecular identifier.

  • Expression system: Express the library in a cellular system (e.g., HEK293T cells) where each cell expresses a single variant from a defined genomic locus .

  • Functional assay: Measure a relevant functional property, such as plasma membrane expression with and without retinal, using flow cytometry or other high-throughput methods.

  • Data analysis: Calculate the effect of each mutation on the measured property and correlate with structural information.

This approach has been successfully applied to study pathogenic rhodopsin variants and could similarly be used to investigate:

Analysis TypeInformation GainedApplication to B. nicolskii
Expression profilingStability effects of mutationsIdentify destabilizing mutations
Ligand responseRetinal binding effectsMap residues critical for chromophore interaction
Spectral shiftsλmax alterationsIdentify novel spectral tuning sites
Evolutionary conservationFunctional constraintsDetermine evolutionary pressure on specific regions

Such comprehensive mutational data can reveal principles governing rhodopsin folding, stability, and function that might not be apparent from studying a limited set of variants .

What is the optimal protocol for expression and purification of recombinant Batrachocottus nicolskii Rhodopsin?

The optimal protocol for expression and purification involves several critical steps:

  • Expression system selection: While the commercial recombinant protein is expressed in E. coli , mammalian expression systems like HEK293T cells may provide better folding for functional studies .

  • Expression conditions:

    • For E. coli: Use an inducible promoter system with careful optimization of induction temperature (typically 16-20°C) and duration (12-18 hours) to minimize inclusion body formation

    • For mammalian cells: Transiently transfect with the rhodopsin construct and culture for 48-72 hours in the presence of 9-cis retinal (5-10 μM) when studying functional properties

  • Purification steps:

    • Cell lysis under dim red light conditions to preserve photoreactive properties

    • Membrane isolation by differential centrifugation

    • Solubilization in mild detergents (n-dodecyl-β-D-maltopyranoside or DDM is often used)

    • Affinity chromatography using the His-tag

    • Size exclusion chromatography for final purification

  • Storage conditions:

    • Store purified protein at -20°C/-80°C

    • Add 6% trehalose to the storage buffer (Tris/PBS-based, pH 8.0)

    • Avoid repeated freeze-thaw cycles

    • For reconstituted samples, aliquot with 5-50% glycerol (final concentration)

This protocol maximizes protein yield while maintaining the structural integrity and functional properties necessary for downstream applications.

How should researchers reconstitute and handle Batrachocottus nicolskii Rhodopsin for spectroscopic studies?

For spectroscopic studies, proper reconstitution and handling are crucial:

  • Reconstitution procedure:

    • Briefly centrifuge the vial containing lyophilized protein

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • For long-term storage, add glycerol to a final concentration of 5-50%

  • Chromophore preparation:

    • Prepare 11-cis retinal in ethanol under dim red light

    • Determine concentration spectrophotometrically using ε = 24,400 M⁻¹cm⁻¹ at 380 nm

  • Protein-chromophore reconstitution:

    • Mix protein with 11-cis retinal in slight molar excess (typically 1.1:1)

    • Incubate at 4°C in the dark for 12-24 hours to allow Schiff base formation

    • Monitor reconstitution by following the increase in absorbance at ~500 nm

  • Handling precautions:

    • Perform all procedures under dim red light (>650 nm) to prevent unwanted photoactivation

    • Maintain temperature control (4°C) during handling

    • Use fresh aliquots for each experiment to avoid degradation from repeated freeze-thaw cycles

  • Spectroscopic measurement conditions:

    • Use temperature-controlled cuvette holders (typically 20°C)

    • Scan in appropriate wavelength range (typically 250-650 nm)

    • Take multiple scans and average to improve signal-to-noise ratio

    • Include proper controls (buffer blanks, denatured samples)

Following these procedures ensures reliable spectroscopic data that accurately reflects the photochemical properties of the rhodopsin.

What methods are available for assessing the functional properties of Batrachocottus nicolskii Rhodopsin variants?

Several complementary methods can be employed to assess functional properties:

  • UV-Visible Spectroscopy:

    • Determination of absorption maxima (λmax)

    • Monitoring photobleaching kinetics and photoproduct formation

    • Thermal stability measurements by following absorbance changes during temperature ramping

  • Fluorescence Spectroscopy:

    • Intrinsic tryptophan fluorescence to monitor conformational changes

    • Fluorescence resonance energy transfer (FRET) for protein-protein interaction studies

  • Biochemical Assays:

    • G-protein activation assays to measure signaling efficiency

    • Retinal binding kinetics using radiolabeled or fluorescent retinal analogs

    • pH-dependent conformational stability assays

  • Cellular Assays:

    • Membrane expression quantification by flow cytometry or immunofluorescence

    • Trafficking studies using fluorescently tagged rhodopsin variants

    • Calcium imaging to monitor downstream signaling in live cells

  • Structural Analysis:

    • Circular dichroism to assess secondary structure content

    • Limited proteolysis to probe conformational differences

    • Crosslinking studies to identify interaction partners

These methods provide comprehensive insights into how specific mutations affect various aspects of rhodopsin function, from photochemistry to signal transduction.

How should researchers interpret spectral tuning data from Batrachocottus nicolskii Rhodopsin variants?

Interpretation of spectral tuning data requires careful analysis considering multiple factors:

  • Wavelength shift quantification:

    • Calculate precise λmax values using peak fitting algorithms rather than raw data points

    • Report both the absolute λmax and the shift relative to wild-type (Δλmax)

    • Consider the possibility of multiple spectral species by deconvoluting complex absorption curves

  • Structure-function correlation:

    • Map mutations onto 2D and 3D structural models to visualize their location relative to the retinal binding pocket

    • Use molecular dynamics simulations to predict how mutations alter chromophore-protein interactions

    • Compare observed shifts with theoretical predictions based on quantum mechanical/molecular mechanical (QM/MM) calculations

  • Evolutionary context:

    • Compare observed shifts with natural variation across cottoid species from different habitats

    • Consider whether shifts correlate with depth distribution in Lake Baikal

    • Evaluate whether the same amino acid positions are involved in spectral tuning in other vertebrate visual pigments

  • Statistical analysis:

    • Use appropriate statistical tests to determine significance of observed shifts

    • Account for experimental uncertainties in measurements

    • Consider multiple trials and biological replicates

  • Comparative analysis table:

Mutationλmax (nm)Δλmax (nm)Location in StructureProposed MechanismEvolutionary Significance
Position 118[value][value][description][mechanism]Found in deep-water species
Position 215[value][value][description][mechanism]Variable across depths
Position 269[value][value][description][mechanism]Conserved in shallow-water species

This methodical approach ensures that spectral tuning data is interpreted in a biologically meaningful context.

What considerations are important when analyzing the stability of Batrachocottus nicolskii Rhodopsin variants?

Analysis of rhodopsin stability requires a multifaceted approach:

These analyses help distinguish between variants with primary defects in folding, chromophore binding, or post-translational trafficking, which is essential for understanding the molecular basis of functional differences.

How can researchers correlate structural features with evolutionary adaptation in Batrachocottus nicolskii Rhodopsin?

Correlating structure with evolutionary adaptation requires integrated analysis:

  • Phylogenetic mapping:

    • Construct a phylogenetic tree of cottoid fish rhodopsins

    • Map amino acid substitutions onto the tree

    • Identify branches with accelerated rates of evolution

  • Selection analysis:

    • Calculate dN/dS ratios to identify sites under positive or purifying selection

    • Perform branch-site tests to detect episodic selection

    • Use ancestral state reconstruction to infer the sequence of evolutionary changes

  • Structural mapping:

    • Locate evolutionarily variable sites on the 3D structure

    • Identify structural clusters of co-evolving residues

    • Determine if variable sites correlate with functional regions (e.g., retinal binding pocket, G-protein interaction surface)

  • Environmental correlation:

    • Correlate amino acid variants with habitat parameters (depth, light spectrum, temperature)

    • Test for convergent evolution in species occupying similar niches

    • Assess if similar adaptations occur in other aquatic environments

  • Functional validation:

    • Reconstruct and express ancestral rhodopsin sequences

    • Test the functional properties of reconstructed ancestral proteins

    • Engineer rhodopsin variants with combinations of ancestral and derived states to trace the trajectory of adaptation

This integrated approach provides robust evidence for adaptive evolution and illuminates the molecular mechanisms underlying visual adaptation to specific environments.

What are the common challenges in expressing recombinant Batrachocottus nicolskii Rhodopsin and how can they be addressed?

Researchers often encounter several challenges when expressing rhodopsins:

  • Low expression levels:

    • Problem: Membrane proteins often express poorly in heterologous systems

    • Solutions:

      • Optimize codon usage for the expression host

      • Use specialized expression vectors with strong promoters

      • Co-express with molecular chaperones

      • Lower expression temperature (16-20°C)

      • Add chemical chaperones to the culture medium

  • Inclusion body formation:

    • Problem: Misfolded rhodopsin aggregates in inclusion bodies, especially in E. coli

    • Solutions:

      • Express as fusion with solubility-enhancing tags (MBP, SUMO)

      • Optimize induction conditions (lower IPTG concentration, longer induction at lower temperature)

      • Consider refolding protocols if inclusion bodies are unavoidable

      • Switch to eukaryotic expression systems

  • Poor chromophore incorporation:

    • Problem: Inefficient Schiff base formation

    • Solutions:

      • Ensure proper protein folding before chromophore addition

      • Optimize chromophore:protein ratio (typically 1.1-1.5:1)

      • Extend incubation time for chromophore binding

      • Verify chromophore quality by spectroscopy before use

  • Protein instability:

    • Problem: Rapid degradation after purification

    • Solutions:

      • Include protease inhibitors throughout purification

      • Add stabilizing agents (glycerol, trehalose)

      • Maintain strict temperature control

      • Consider detergent screening to identify optimal stabilizing conditions

      • Reconstitute into nanodiscs or liposomes for increased stability

These strategies significantly improve the yield and quality of recombinant Batrachocottus nicolskii Rhodopsin for research applications.

How can researchers address inconsistencies in spectroscopic data from Batrachocottus nicolskii Rhodopsin experiments?

Inconsistencies in spectroscopic data may arise from several sources:

  • Sample heterogeneity:

    • Problem: Mixture of properly folded and misfolded species

    • Solutions:

      • Perform additional purification steps (e.g., size exclusion chromatography)

      • Use sucrose gradient centrifugation to separate different conformational states

      • Verify sample homogeneity by SDS-PAGE and native PAGE

  • Incomplete chromophore incorporation:

    • Problem: Variable proportion of opsin without chromophore

    • Solutions:

      • Monitor reconstitution spectrophotometrically until absorbance stabilizes

      • Calculate and verify molar ratios of protein and chromophore

      • Purify holo-protein from apo-protein after reconstitution

  • Light exposure:

    • Problem: Unintended photoactivation altering spectral properties

    • Solutions:

      • Work under dim red light (>650 nm)

      • Use reference samples kept in identical conditions except for the experimental variable

      • Implement strict light control protocols in the laboratory

  • Buffer and detergent effects:

    • Problem: Different buffers or detergents alter spectral properties

    • Solutions:

      • Standardize buffer composition across experiments

      • Test multiple detergents and report conditions explicitly

      • Include internal standards for calibration

  • Instrument variability:

    • Problem: Different spectrophotometers may give slightly different λmax values

    • Solutions:

      • Calibrate instruments regularly

      • Use internal standards

      • Report raw spectra alongside processed data

      • Perform measurements on the same instrument when comparing variants

Addressing these issues ensures reproducible and reliable spectroscopic data for comparing Batrachocottus nicolskii Rhodopsin variants.

What approaches can researchers use to resolve contradictions between computational predictions and experimental results for Batrachocottus nicolskii Rhodopsin variants?

When computational predictions and experimental results conflict, several approaches can help resolve the contradictions:

  • Revisit model assumptions:

    • Strategy: Examine the structural template used for modeling

    • Actions:

      • Use alternative template structures if available

      • Compare multiple modeling algorithms (Rosetta, MODELLER, AlphaFold)

      • Verify that the model accommodates the chromophore correctly

  • Refine experimental conditions:

    • Strategy: Ensure experimental conditions match computational parameters

    • Actions:

      • Test multiple pH conditions and ionic strengths

      • Vary detergent types to better mimic the computational environment

      • Consider reconstitution in nanodiscs or liposomes for a more native-like environment

  • Incorporate additional data:

    • Strategy: Generate complementary experimental data to constrain models

    • Actions:

      • Perform site-directed spin labeling and EPR measurements

      • Use crosslinking studies to verify predicted residue proximities

      • Apply hydrogen-deuterium exchange mass spectrometry to probe structure

  • Iterative refinement:

    • Strategy: Use experimental data to improve computational models

    • Actions:

      • Incorporate experimental constraints into the modeling process

      • Perform molecular dynamics simulations starting from the refined model

      • Re-evaluate energy calculations with experimental feedback

  • Identify indirect effects:

    • Strategy: Consider that mutations may have effects beyond their immediate vicinity

    • Actions:

      • Analyze potential allosteric networks in the protein

      • Examine effects on protein dynamics rather than just static structure

      • Consider interactions with membrane lipids not captured in simplified models

This iterative process between computation and experiment ultimately leads to a more accurate understanding of structure-function relationships in Batrachocottus nicolskii Rhodopsin.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.