Recombinant Bdellovibrio bacteriovorus ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, storage temperature, and protein stability. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Bd0009; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100)
Target Names
atpB
Target Protein Sequence
MSFNWTQLVPGVGHEYAHVATLGIATVAAVGIGAAARASLGKGEAAVLPASKFSLRGIFE LLTEMTSGLADMVIGEHGKHYIPFFASVFFFILFNNLLGMIPGMTPATENMNTTFGFGVL MFLFYNFQGVKENGPVAYLKHFMGPVIFLAPLMFVIEIVSHIVRPFSLGLRLANVMMGDH TVLSVFLDLVPIGVPIPFYVMGLFVCFVQAFVFTLLSMVYVAFAIAHDH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Database Links

KEGG: bba:Bd0009

STRING: 264462.Bd0009

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bdellovibrio bacteriovorus ATP synthase subunit a (atpB) and what is its role in bacterial physiology?

Bdellovibrio bacteriovorus ATP synthase subunit a (atpB) is a critical component of the F0 sector of the ATP synthase complex. This protein (UniProt ID: Q6MRR3) consists of 229 amino acids and functions as part of the membrane-embedded proton channel that facilitates ATP synthesis. In the context of B. bacteriovorus physiology, ATP synthase plays a crucial role in energy metabolism, particularly during the predatory lifecycle of this bacterium .

B. bacteriovorus is a predatory bacterium with a unique biphasic lifecycle consisting of a non-replicating attack phase (AP) and an intraperiplasmic phase (IP). During the AP, the bacterium requires significant energy to power its high-speed swimming to locate prey, while the IP involves invasion and consumption of Gram-negative bacteria to acquire nutrients for growth and replication . The ATP synthase complex, including the atpB subunit, is essential for generating the ATP required for these energy-intensive processes.

How does the lifecycle of Bdellovibrio bacteriovorus influence ATP synthase function and regulation?

The biphasic lifecycle of B. bacteriovorus significantly influences ATP synthase function and regulation. During the attack phase, the bacterium requires substantial energy to power its high-speed motility (up to 100 body lengths per second) as it searches for prey. ATP synthase activity would be crucial during this phase to maintain adequate ATP levels for flagellar motion .

Upon entering the intraperiplasmic phase, B. bacteriovorus invades a prey bacterium and converts it into a rounded structure called a bdelloplast. Inside this structure, the predator secretes hydrolases to digest prey components and utilizes the nutrients for growth and replication over approximately 3-4 hours . During this phase, the regulation of ATP synthase likely changes to accommodate the different energy requirements.

Research has shown that specific promoters are active during the attack phase of B. bacteriovorus, suggesting differential gene expression throughout its lifecycle . This temporal regulation likely extends to ATP synthase components, including atpB, to ensure appropriate energy production during different predatory stages. Understanding these regulatory mechanisms provides insights into the adaptation of energy metabolism during predator-prey interactions.

What are the optimal conditions for recombinant expression of B. bacteriovorus atpB in E. coli systems?

Successful recombinant expression of B. bacteriovorus atpB in E. coli systems requires careful optimization of several parameters. Based on established protocols for membrane proteins and specifically for ATP synthase components:

  • Expression system: E. coli is the preferred host for recombinant expression of full-length atpB (1-229 amino acids) with an N-terminal His-tag . BL21(DE3) or similar strains designed for membrane protein expression are recommended.

  • Vector selection: Vectors with moderate to low copy numbers are preferred to prevent toxicity from membrane protein overexpression. The pET system with T7 promoter control offers inducible expression that can be regulated to optimize protein production.

  • Induction conditions: Lower temperatures (16-25°C) during induction can improve proper folding of membrane proteins. IPTG concentration should be optimized (typically 0.1-0.5 mM) with induction periods of 4-16 hours.

  • Growth media: Rich media such as Terrific Broth (TB) or auto-induction media can increase biomass and protein yield. Supplementation with glucose (0.5%) can help reduce basal expression before induction.

  • Co-expression strategies: Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ) can improve folding and stability of the recombinant protein.

When optimizing expression, it's advisable to perform small-scale expression trials with variations in these parameters, followed by Western blot analysis using anti-His antibodies to determine the optimal conditions before scaling up.

What purification strategies yield the highest purity and activity of recombinant atpB protein?

Purifying membrane proteins like atpB requires specialized approaches to maintain protein integrity and functionality:

  • Membrane isolation: After cell lysis, differential centrifugation is used to isolate membrane fractions (typically 100,000 × g for 1 hour).

  • Solubilization: Membrane proteins require detergent solubilization. For ATP synthase components, mild detergents such as n-dodecyl-β-D-maltoside (DDM), digitonin, or CHAPS at concentrations just above their critical micelle concentration (CMC) are effective while preserving protein structure.

  • Affinity chromatography: The N-terminal His-tag allows purification using immobilized metal affinity chromatography (IMAC) with Ni-NTA or Co-NTA resins . A stepwise imidazole gradient (10-500 mM) in the presence of detergent is recommended.

  • Size exclusion chromatography: As a polishing step, size exclusion chromatography separates the target protein from aggregates and other contaminants while maintaining the protein in its detergent-solubilized state.

  • Buffer optimization: The final protein should be stored in a stabilizing buffer. For atpB, Tris/PBS-based buffer at pH 8.0 with 6% trehalose has proven effective . Addition of glycerol (5-50%) is recommended for long-term storage at -20°C/-80°C.

The purified protein should be assessed for purity by SDS-PAGE (>90% purity is achievable) , and its identity confirmed by Western blotting or mass spectrometry.

How can researchers effectively reconstitute purified atpB into liposomes for functional studies?

Reconstitution of purified atpB into liposomes enables functional studies of its proton translocation activity. A methodical approach includes:

  • Liposome preparation: Synthetic lipids (such as POPC, POPE, and cardiolipin in a ratio mimicking bacterial membranes) are dissolved in chloroform, dried to a thin film, and rehydrated in reconstitution buffer (typically 10-20 mM HEPES, 100 mM KCl, pH 7.4).

  • Liposome sizing: Extrusion through polycarbonate membranes (100-200 nm pore size) creates uniform liposomes suitable for protein incorporation.

  • Protein incorporation: Several methods are effective:

    • Detergent-mediated reconstitution: Liposomes are partially solubilized with detergent before adding purified protein, followed by detergent removal using Bio-Beads or dialysis.

    • Direct incorporation: Using low lipid-to-protein ratios (50:1 to 100:1 by weight) and gentle agitation.

  • Verification of incorporation: Successful reconstitution can be verified by:

    • Freeze-fracture electron microscopy to visualize protein distribution

    • Sucrose gradient centrifugation to separate protein-containing liposomes

    • Western blotting of liposome fractions

  • Functional assessment: Proton translocation activity can be measured using:

    • pH-sensitive fluorescent dyes (ACMA or pyranine) to monitor internal pH changes

    • Membrane potential-sensitive dyes (DiSC3(5)) to detect membrane potential formation

When reconstituting atpB alone, it's important to note that the complete F0 sector (including other subunits) is typically required for functional proton translocation. Therefore, co-reconstitution with complementary subunits may be necessary for comprehensive functional studies.

What techniques are most effective for analyzing the structural dynamics of atpB within the ATP synthase complex?

Multiple complementary techniques provide insights into the structural dynamics of atpB within the ATP synthase complex:

  • Cryo-electron microscopy (cryo-EM): This has become the gold standard for determining the structure of membrane protein complexes like ATP synthase. Recent advances allow visualization of the F0 sector, including the a-subunit (atpB), at near-atomic resolution. Cryo-EM can capture different conformational states, providing insights into the dynamic movement of subunits during proton translocation .

  • Cross-linking coupled with mass spectrometry (XL-MS): Chemical cross-linking followed by proteomic analysis can map spatial relationships between residues in different subunits, illuminating the interaction network of atpB with neighboring subunits.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique measures the exchange rate of hydrogen atoms with deuterium from the solvent, identifying solvent-exposed regions and conformational changes under different conditions.

  • Molecular dynamics (MD) simulations: Computational simulations can model the dynamics of atpB within the membrane environment, predicting conformational changes during proton translocation and interactions with other subunits.

  • Site-directed spin labeling electron paramagnetic resonance (SDSL-EPR): This technique introduces spin labels at specific residues and measures distances between them, providing information about conformational changes during function.

How does the atpB subunit from B. bacteriovorus compare structurally and functionally to homologous proteins in other bacterial species?

Comparative analysis of atpB from B. bacteriovorus with homologous proteins from other bacterial species reveals both conserved features and unique adaptations:

  • Sequence conservation: Multiple sequence alignment shows that B. bacteriovorus atpB shares conserved residues with other bacterial a-subunits, particularly in regions involved in proton translocation. Key arginine residues that form part of the proton pathway are typically conserved across species.

  • Structural adaptations: While the core structure is conserved, B. bacteriovorus atpB likely contains adaptations that reflect its predatory lifestyle. These may include modifications in transmembrane helix arrangement to accommodate the high-energy demands during the attack phase.

  • Functional comparison: Unlike some bacteria like Mycobacterium species that have mechanisms to prevent ATP hydrolysis during stress, B. bacteriovorus may require continuous ATP synthesis during predation. This functional difference might be reflected in structural variations in the ATP synthase complex .

  • Regulatory elements: Comparative analysis suggests that regulatory elements that control ATP synthase activity differ between species. In Mycobacterium, the extended C-terminal domain (αCTD) of subunit α is important for self-inhibition of ATP hydrolysis . Similar regulatory mechanisms may exist in B. bacteriovorus but would likely be adapted to its unique lifecycle.

  • Evolutionary adaptations: B. bacteriovorus has evolved as an obligate predator, which may have driven unique adaptations in its energy-generating systems. These adaptations could include optimizations in the ATP synthase complex to rapidly generate energy during the attack phase.

This comparative analysis provides insights into both the fundamental mechanisms of ATP synthase function and the species-specific adaptations that have evolved to meet diverse ecological niches.

What is the relationship between atpB function and the predatory lifecycle of B. bacteriovorus?

The function of atpB within the ATP synthase complex is intimately linked to the predatory lifecycle of B. bacteriovorus through several mechanisms:

  • Energy requirements during attack phase: During the attack phase, B. bacteriovorus exhibits remarkably high swimming speeds to locate prey. This high-speed motility requires substantial ATP production, making efficient ATP synthase function critical. The atpB subunit, as part of the proton channel, must efficiently couple proton translocation to ATP synthesis to maintain these energy levels .

  • Metabolic transitions: B. bacteriovorus transitions between the attack phase and intraperiplasmic growth phase, each with distinct metabolic requirements. During the intraperiplasmic phase, the predator consumes prey resources, potentially altering the activity and regulation of ATP synthase components including atpB.

  • Gene expression patterns: Research has identified promoters that are specifically active during the attack phase of B. bacteriovorus, suggesting differential expression of genes throughout its lifecycle . The expression of atpB and other ATP synthase components may be regulated to match the changing energy demands during predation.

  • Adaptation to prey resources: As B. bacteriovorus invades and consumes different prey bacteria, it must adapt to varying nutrient conditions. The function of ATP synthase, including the atpB subunit, likely adjusts to these changing conditions to maintain energy homeostasis.

  • Potential genetic engineering applications: Studies have demonstrated that engineering components of B. bacteriovorus, such as the flagellar sigma factor fliA, can alter predation kinetics . Similar modifications to ATP synthase components, including atpB, could potentially enhance or alter predatory efficiency.

Understanding this relationship provides insights into both fundamental bacterial energetics and the specialized adaptations that enable the predatory lifestyle of B. bacteriovorus.

How can genetic manipulation techniques be used to study atpB function in B. bacteriovorus?

Genetic manipulation of atpB in B. bacteriovorus presents both challenges and opportunities for understanding its function:

  • Plasmid-based expression systems: Researchers have developed tools for genetic manipulation of B. bacteriovorus, including robust promoters active during the attack phase. These systems can be used to express modified versions of atpB to study its function . Key considerations include:

    • Selection of appropriate promoters (native or synthetic)

    • Optimization of ribosome binding sites for efficient translation

    • Appropriate selection markers (kanamycin resistance has been successfully used)

  • Riboswitch-based regulation: Theophylline-activated riboswitches have been demonstrated to function in B. bacteriovorus and can be used to create conditional expression systems for atpB . This allows for:

    • Temporal control of atpB expression

    • Dose-dependent regulation of protein levels

    • Investigation of phenotypic effects under varying expression conditions

  • Chromosomal modifications: Techniques for chromosomal insertion have been established in B. bacteriovorus. These methods typically involve:

    • Creation of constructs with homologous regions flanking the insertion site

    • Use of suicide vectors like pK18mobsacB that allow for selection of double crossover events

    • Selection and verification of mutants through PCR and sequencing

  • CRISPR-Cas9 genome editing: Adapted CRISPR systems can potentially be used for precise genome editing of atpB, allowing:

    • Introduction of point mutations to study specific residues

    • Creation of truncations or domain swaps

    • Insertion of reporter tags for localization studies

  • Functional complementation: For essential genes like atpB, conditional knockout strategies coupled with complementation can reveal functional importance:

    • Expression of wild-type atpB from an inducible promoter

    • Subsequent replacement or modification of the native gene

    • Analysis of growth, predation, and ATP synthesis phenotypes

These genetic approaches, combined with biochemical and structural analyses, provide powerful tools for dissecting the role of atpB in the unique predatory lifecycle of B. bacteriovorus.

What are the most reliable assays for measuring atpB-mediated proton translocation in reconstituted systems?

Measuring atpB-mediated proton translocation in reconstituted systems requires specialized assays that can detect proton movement across membranes:

  • Fluorescence-based pH gradient assays:

    • ACMA quenching: The fluorescent dye 9-amino-6-chloro-2-methoxyacridine (ACMA) is quenched upon protonation. When trapped inside liposomes, ACMA fluorescence decreases as protons enter, providing a sensitive measure of proton translocation.

    • Pyranine fluorescence: This pH-sensitive dye can be trapped inside liposomes, and its ratiometric fluorescence properties (excitation at 450/405 nm) provide quantitative measurements of internal pH changes.

    Experimental setup typically involves:

    • Reconstituting atpB (often with other F0 subunits) into liposomes

    • Loading liposomes with fluorescent dye

    • Establishing a pH gradient (e.g., by adding an acid pulse)

    • Monitoring fluorescence changes over time

  • Membrane potential measurements:

    • Potential-sensitive dyes: Fluorescent dyes like DiSC3(5) or Oxonol VI redistribute across membranes in response to membrane potential changes, with corresponding changes in fluorescence.

    • Electrode-based measurements: Ion-selective electrodes can directly measure proton concentration changes in the external medium.

  • Radioactive ion flux assays:

    • Tritiated water (³H₂O) exchange can measure water movement associated with proton translocation

    • ²²Na⁺ or ⁴²K⁺ can be used to measure secondary ion movements coupled to proton translocation

  • Patch-clamp electrophysiology:

    • For larger reconstituted systems or giant liposomes, patch-clamp techniques can directly measure ion currents through the reconstituted proteins.

Data analysis should include:

  • Calibration curves relating fluorescence to pH or membrane potential

  • Kinetic analysis of proton translocation rates

  • Inhibitor studies to confirm specificity (e.g., using DCCD or oligomycin)

  • Comparison between wild-type and mutant proteins

It's important to note that atpB alone may not form a functional proton channel; reconstitution with other F0 subunits may be necessary for complete functionality.

How can researchers effectively investigate the interaction between atpB and other ATP synthase subunits?

Investigating interactions between atpB and other ATP synthase subunits requires a multi-faceted approach:

  • Co-immunoprecipitation (Co-IP) and pull-down assays:

    • Using antibodies against atpB or epitope tags (His, FLAG, etc.) to precipitate the protein complex

    • Analyzing co-precipitated proteins by mass spectrometry or Western blotting

    • Performing reciprocal pull-downs with different subunits as bait

    These approaches can identify direct binding partners and stable interactions, though they may miss transient or weak interactions.

  • Chemical cross-linking coupled with mass spectrometry (XL-MS):

    • Treating purified ATP synthase complexes or membrane preparations with cross-linkers of defined length

    • Digesting cross-linked complexes and analyzing by mass spectrometry

    • Identifying cross-linked peptides to map spatial relationships between subunits

    This technique provides distance constraints between residues, revealing the structural organization of the complex.

  • Förster Resonance Energy Transfer (FRET):

    • Engineering fluorescent protein fusions or introducing fluorescent labels at specific sites

    • Measuring energy transfer between donor and acceptor fluorophores

    • Calculating distances between labeled sites based on FRET efficiency

    FRET can detect interactions in living cells and provide dynamic information about conformational changes.

  • Bacterial two-hybrid systems:

    • Designing fusion constructs with atpB and potential interaction partners

    • Measuring reporter gene expression as an indicator of protein-protein interaction

    • Screening libraries to identify novel interaction partners

    This approach allows high-throughput screening but may have limitations for membrane proteins.

  • Cryo-electron microscopy (cryo-EM):

    • Determining the structure of the entire ATP synthase complex

    • Analyzing the interfaces between atpB and neighboring subunits

    • Comparing structures in different conformational states

    Cryo-EM provides direct visualization of subunit arrangements and interactions .

  • Mutagenesis studies:

    • Introducing mutations at predicted interaction sites

    • Assessing effects on complex assembly and function

    • Performing suppressor screens to identify complementary mutations in interaction partners

    This approach can validate and functionally characterize predicted interactions.

By combining multiple complementary techniques, researchers can build a comprehensive understanding of how atpB interacts with other subunits in the context of ATP synthase structure and function.

How might atpB function be exploited in developing novel antimicrobial approaches?

The unique characteristics of B. bacteriovorus atpB present several opportunities for antimicrobial development:

  • B. bacteriovorus as a living antibiotic: The predatory nature of B. bacteriovorus against various Gram-negative bacteria makes it a potential biocontrol agent . Understanding and potentially enhancing atpB function could improve the predatory efficiency through:

    • Genetic modifications to increase ATP synthesis capacity

    • Engineering regulatory elements to optimize energy production during predation

    • Creating strains with enhanced predatory capabilities against specific pathogens

  • Structure-based drug design: Detailed structural information about atpB could inform the development of inhibitors that selectively target pathogenic bacteria. By comparing atpB structures across species:

    • Species-specific pocket differences could be identified

    • Selective inhibitors could be designed that target pathogens while sparing beneficial bacteria

    • Virtual screening and molecular docking approaches could accelerate discovery

  • Peptide inhibitors: Using knowledge of atpB's interaction surfaces with other ATP synthase subunits, peptide inhibitors could be designed to:

    • Disrupt essential protein-protein interactions

    • Interfere with proton translocation

    • Prevent proper assembly of the ATP synthase complex

  • Bacteriophage-delivered inhibitors: Engineered bacteriophages could deliver:

    • CRISPR-Cas systems targeting atpB genes

    • RNA interference molecules suppressing atpB expression

    • Proteins that competitively bind to atpB and disrupt function

  • Immunological approaches: atpB-specific antibodies or immunomodulators could:

    • Target surface-exposed epitopes on certain bacterial pathogens

    • Enhance immune recognition of pathogens

    • Disrupt ATP synthesis in targeted bacterial populations

Research in Mycobacterium has already validated ATP synthase as a drug target , and similar approaches could be applied to other pathogens using comparative analysis of atpB structure and function across species.

What role might atpB play in the potential development of B. bacteriovorus as a biocontrol agent?

The role of atpB in developing B. bacteriovorus as a biocontrol agent encompasses several critical aspects:

  • Energy efficiency optimization: As a component of ATP synthase, atpB is crucial for energy production during predation. Engineering atpB to enhance ATP synthesis efficiency could:

    • Increase predatory activity and swimming speed

    • Improve hunting capabilities in complex environments

    • Enhance survival under energy-limited conditions

  • Host range modulation: B. bacteriovorus can prey on various Gram-negative bacteria, including human pathogens . Modifications to energy metabolism through atpB engineering might:

    • Expand the predatory range to additional pathogenic species

    • Increase efficiency against specific target pathogens

    • Allow adaptation to different environmental conditions

  • Persistence and stability: For effective biocontrol, B. bacteriovorus must persist in the target environment. Optimized energy metabolism through atpB modifications could:

    • Extend survival during periods without prey

    • Improve stress tolerance through enhanced energy reserves

    • Increase competitive fitness in complex microbial communities

  • Controllable predation: Development of switchable predatory activity would be valuable for biocontrol applications. Technologies demonstrated in B. bacteriovorus, such as theophylline-responsive riboswitches , could be applied to atpB regulation to:

    • Create inducible predation systems

    • Enable temporal control of biocontrol activity

    • Allow precise management of predator populations

  • Monitoring systems: Fusion of reporter proteins to atpB or related ATP synthase components could:

    • Enable tracking of biocontrol agents in environmental applications

    • Provide real-time assessment of metabolic state and predatory potential

    • Facilitate measurement of predatory activity in diverse settings

Studies have already demonstrated that B. bacteriovorus can effectively prey on human pathogens like Acinetobacter, Pseudomonas, and Klebsiella species , highlighting its potential as a biocontrol agent. Optimizing atpB function represents one avenue to enhance this potential for medical and environmental applications.

What are the latest methodological advances in studying membrane protein dynamics that could be applied to atpB research?

Recent methodological advances in membrane protein research offer powerful new approaches for studying atpB dynamics:

  • Cryo-electron tomography (cryo-ET) with subtomogram averaging:

    • Enables visualization of membrane proteins in their native cellular environment

    • Captures structural heterogeneity and conformational states

    • Can be combined with genetic labeling for in situ protein identification

    This technique could reveal how atpB and the ATP synthase complex are organized within the bacterial membrane and how this organization changes during the predatory lifecycle.

  • Time-resolved structural methods:

    • Time-resolved cryo-EM: Capturing structural snapshots during function using microfluidic mixing devices

    • Time-resolved X-ray free-electron laser (XFEL) crystallography: Obtaining structural information on ultrafast timescales

    These approaches could elucidate the conformational changes in atpB during proton translocation and ATP synthesis.

  • Advanced fluorescence techniques:

    • Single-molecule FRET (smFRET): Detecting distance changes between labeled sites in individual protein molecules

    • Fluorescence correlation spectroscopy (FCS): Measuring diffusion and dynamics of labeled proteins

    • Super-resolution microscopy: Visualizing protein distribution and dynamics below the diffraction limit

    These techniques could track the movement and conformational changes of atpB in real-time, both in reconstituted systems and potentially in living cells.

  • Mass spectrometry innovations:

    • Native mass spectrometry: Analyzing intact membrane protein complexes

    • Protein footprinting: Measuring solvent accessibility of different regions

    • Ion mobility-mass spectrometry: Separating conformational states

    These approaches could provide insights into atpB structure, interactions, and conformational dynamics.

  • Computational methods:

    • Enhanced sampling molecular dynamics: Exploring conformational space more efficiently

    • Coarse-grained simulations: Modeling larger systems over longer timescales

    • Machine learning approaches: Predicting structural features and functional sites

    Computational methods can complement experimental approaches by predicting dynamics that may be difficult to observe experimentally.

  • Nanodiscs and styrene-maleic acid lipid particles (SMALPs):

    • Provide more native-like membrane environments than detergent micelles

    • Enable studies of membrane proteins with their surrounding lipids

    • Compatible with various structural and functional techniques

    These membrane mimetics could be used to study atpB in a near-native environment for more physiologically relevant results.

Applying these cutting-edge techniques to atpB research would provide unprecedented insights into its structure, dynamics, and function within the ATP synthase complex and the broader context of B. bacteriovorus predatory behavior .

How does atpB from B. bacteriovorus compare to ATP synthase components in other predatory bacteria?

A comparative analysis of atpB between B. bacteriovorus and other predatory bacteria reveals evolutionary adaptations linked to predatory lifestyles:

FeatureB. bacteriovorusOther Predatory BacteriaNon-Predatory Bacteria
Sequence conservationReferenceHigh similarity in core functional regionsModerate to high similarity in functional domains
Energy efficiencyOptimized for high-speed swimming during attack phaseSimilarly adapted for predatory energy demandsTypically balanced for general metabolism
Regulatory mechanismsLikely specialized for biphasic lifecycleVariable based on predatory strategyOften responsive to general metabolic states
Structural adaptationsPotentially optimized for rapid ATP productionMay show convergent adaptations in other predatorsMore diverse based on ecological niche
Genetic contextPart of ATP synthase operon with possible predation-specific regulationMay show similar operon organization in related predatorsConserved operon structure with species-specific regulation

Studies comparing predatory efficiency across different bacterial predators have shown that B. bacteriovorus and M. aeruginosavorus can attack a wide range of pathogenic bacteria, suggesting that their energy-generating systems, including ATP synthase, are adaptable to different prey environments . This adaptability likely involves specialized features of atpB and other components that optimize energy production under various predatory conditions.

What insights can structural biology provide about the evolution of atpB across different bacterial phyla?

Structural biology offers valuable insights into atpB evolution across bacterial phyla:

  • Structural conservation and divergence:

    • Core structural elements involved in proton translocation show high conservation across phyla

    • Peripheral regions display greater divergence, reflecting adaptation to specific cellular environments

    • Comparative structural analysis reveals how evolutionary pressure maintains function while allowing adaptation

  • Mechanistic evolution:

    • Structural studies of ATP synthase from diverse bacteria, including Mycobacterium, have revealed species-specific elements that regulate ATP hydrolysis and synthesis

    • These elements, such as the extended C-terminal domain (αCTD) in Mycobacterium, represent evolutionary adaptations to specific ecological niches

    • Similar regulatory elements may exist in B. bacteriovorus atpB, adapted to its predatory lifestyle

  • Structural basis for functional specialization:

    • High-resolution structures reveal how subtle changes in transmembrane helix arrangement can affect proton path and efficiency

    • Comparison across species highlights how similar structural frameworks have been fine-tuned for different energy requirements

    • Interface regions between atpB and other subunits show evolutionary co-variation, maintaining critical interactions

  • Adaptation to membrane environments:

    • Variations in membrane composition across bacterial phyla are reflected in the hydrophobic surface properties of atpB

    • These adaptations ensure optimal protein-lipid interactions and function in diverse membrane environments

    • Structural biology techniques can visualize these adaptations through analysis of the protein-lipid interface

  • Evolutionary relationship to eukaryotic counterparts:

    • Structural comparison between bacterial atpB and eukaryotic ATP synthase subunit a reveals evolutionary relationships

    • Conservation of key functional elements suggests fundamental mechanistic similarities despite billions of years of separate evolution

    • Unique features highlight adaptations to different cellular compartments and energy requirements

These structural insights not only illuminate evolutionary history but also provide guidance for engineering atpB with desired properties for biotechnological applications.

How do post-translational modifications and regulatory mechanisms of atpB differ between B. bacteriovorus and other bacteria?

The post-translational modifications (PTMs) and regulatory mechanisms of atpB likely show significant differences between B. bacteriovorus and other bacteria, reflecting their distinct lifestyles:

  • Post-translational modifications:

    • While specific PTMs of B. bacteriovorus atpB are not well-characterized, comparative analysis suggests potential differences in:

      • Phosphorylation patterns that may regulate activity in response to predatory signals

      • Acetylation sites that could modulate protein-protein interactions

      • Redox-sensitive modifications that respond to metabolic states during predation

    • In contrast, ATP synthase components in non-predatory bacteria often show:

      • Growth phase-dependent phosphorylation

      • Stress-responsive modifications

      • Metabolite-sensing modifications

  • Transcriptional regulation:

    • B. bacteriovorus likely employs predation-specific transcriptional regulation:

      • Promoters active specifically during the attack phase have been identified

      • Lifecycle-dependent expression patterns may coordinate ATP synthase activity with predatory needs

      • Prey-responsive regulatory elements may adjust expression based on available resources

    • Non-predatory bacteria typically show:

      • Growth phase-dependent regulation

      • Nutrient-responsive expression

      • Stress-induced regulatory patterns

  • Post-transcriptional control:

    • The discovery that synthetic riboswitches function in B. bacteriovorus suggests:

      • Natural RNA-based regulation may play roles in ATP synthase expression

      • Small RNAs might coordinate expression of energy-related genes during predation

      • mRNA stability may be regulated in a lifecycle-dependent manner

    • These mechanisms may differ from those in non-predatory bacteria, which often respond primarily to general metabolic signals rather than predatory cues.

  • Allosteric regulation:

    • ATP synthase activity in Mycobacterium is regulated by structural elements like the extended C-terminal domain (αCTD) of subunit α

    • B. bacteriovorus may have evolved unique allosteric mechanisms to:

      • Rapidly modulate ATP synthesis during transition between attack and growth phases

      • Optimize energy production based on prey availability

      • Maintain energy homeostasis during different predatory stages

  • Protein-protein interactions:

    • The interaction network of atpB likely includes:

      • Core conserved interactions with other ATP synthase subunits

      • Predation-specific interactions with regulatory proteins

      • Potential interactions with cytoskeletal elements for localization

    • These interaction networks may be significantly different from those in non-predatory bacteria, reflecting the unique cellular organization during predation.

Understanding these regulatory differences provides insights into how energy metabolism has evolved to support the specialized predatory lifestyle of B. bacteriovorus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.