Recombinant Bdellovibrio bacteriovorus Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; Bd2847; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100)
Target Names
mtgA
Target Protein Sequence
MRSRWQTLRKWIVKAVLLFFVSSLGFVLLYRFVPVPLTPLMVIRSVSSVWGEEFVGIHKD
WVPLEEIAPSVQKAVLKAEDYRFFEHNGFDFDAIEKAMKYNKTHKRKKGASTITQQTAKN
VFLWPQRDWVRKGLEAYFTILIESTWPKERIMEVYLNVIELGPGVYGVEAASQKYFKRSA
KNLNPYQASLIAAVLPNPRRFRIDRPSNYVVGRQRRILNRVAPAIPKAADASLLDFLDLK
FDSEEDESAN
Uniprot No.
Target Background
Function
Recombinant *Bdellovibrio bacteriovorus* Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links
KEGG: bba:Bd2847
STRING: 264462.Bd2847
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
