Recombinant Bdellovibrio bacteriovorus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development according to your specifications.
Synonyms
nuoK; Bd3889; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100)
Target Names
nuoK
Target Protein Sequence
MNTEFINNIGLTHYLVLAALLFVMGMAGVLLRRNVIVLLMSIELMLNSVNLTFVAFSKYL GLLDGHIMVFFVMTIAAAEAAVGLALAVSIFKRFNEVNIRFFEHLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. This process couples the redox reaction to proton translocation, where for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane, thereby conserving the redox energy in a proton gradient.
Database Links

KEGG: bba:Bd3889

STRING: 264462.Bd3889

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Bdellovibrio bacteriovorus nuoK protein?

The nuoK protein from Bdellovibrio bacteriovorus is a 107-amino acid subunit of the NADH-quinone oxidoreductase complex (respiratory complex I). Its amino acid sequence is MNTEFINNIGLTHYLVLAALLFVMGMAGVLLRRNVIVLLMSIELMLNSVNLTFVAFSKYLGLLDGHIMVFFVMTIAAAEAAVGLALAVSIFKRFNEVNIRFFEHLKG . This protein functions as a transmembrane component within the NADH dehydrogenase complex, which serves as the primary entry point for electrons into the respiratory chain. While not directly involved in substrate binding, nuoK plays a critical role in the structural integrity of the complex and may participate in proton pumping mechanisms.

The nuoK subunit is highly hydrophobic, containing multiple transmembrane helices that anchor it within the cell membrane. These structural characteristics facilitate its role in maintaining the complex's architecture and potentially contributing to the electron transport-coupled ion translocation process. Understanding this basic structure-function relationship provides the foundation for more sophisticated investigations into the protein's role in Bdellovibrio's unique predatory lifestyle and energy metabolism.

How does recombinant nuoK expression differ from native expression in Bdellovibrio bacteriovorus?

Recombinant nuoK expression in heterologous systems (typically E. coli) involves significant differences from native expression in B. bacteriovorus . When expressed recombinantly, the protein is typically modified with affinity tags (such as His-tags) to facilitate purification, which are not present in the native form. This modification can alter certain biochemical properties including solubility, stability, and potentially minor aspects of protein folding or interaction surfaces.

The expression environment also differs substantially: E. coli possesses different membrane composition, chaperone proteins, and post-translational modification machinery compared to B. bacteriovorus. These differences can impact protein folding and stability. Additionally, recombinant expression typically employs strong inducible promoters that result in expression levels significantly higher than native conditions, potentially leading to inclusion body formation if the protein is overexpressed.

To mitigate these differences, researchers often optimize expression conditions by:

  • Testing various E. coli strains specialized for membrane protein expression

  • Adjusting induction parameters (temperature, inducer concentration, duration)

  • Employing fusion partners that enhance solubility

  • Using detergents appropriate for membrane protein extraction and stabilization

These strategies help obtain functionally similar protein to the native form while enabling the production quantities needed for structural and functional studies.

What are the common challenges in expressing and purifying recombinant nuoK protein?

Expressing and purifying nuoK presents several challenges characteristic of membrane proteins. The primary difficulties include:

  • Low expression yields: As a small, hydrophobic membrane protein, nuoK often expresses at lower levels than soluble proteins. Researchers typically optimize codon usage, test multiple expression strains (such as C41/C43 designed for membrane proteins), and evaluate various induction protocols to improve yields .

  • Protein aggregation: The hydrophobic nature of nuoK can lead to aggregation and inclusion body formation. This is often addressed by lowering expression temperature (16-20°C), reducing inducer concentration, and incorporating solubility-enhancing fusion partners.

  • Extraction efficiency: Efficient extraction from membranes requires careful selection of detergents. For nuoK, detergents like n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or a combination approach often proves effective.

  • Maintaining native conformation: The functionality of nuoK depends on proper folding and membrane integration. Using mild solubilization conditions and including lipids during purification helps maintain native-like conformation.

  • Purification complexity: The small size (107 amino acids) and hydrophobic nature of nuoK can complicate chromatographic separation. Multi-step purification protocols typically combine immobilized metal affinity chromatography (leveraging the His-tag) with size exclusion chromatography.

Researchers have developed optimized protocols that typically involve membrane fraction isolation followed by controlled solubilization and chromatographic purification under conditions that preserve protein stability and function.

How does the nuoK subunit contribute to the predatory capabilities of Bdellovibrio bacteriovorus?

The nuoK subunit's role in Bdellovibrio's predatory lifestyle extends beyond basic respiratory functions, integrating with the organism's unique energy requirements during different predation phases. The NADH-quinone oxidoreductase complex containing nuoK serves as a critical component in energy generation during the high-energy-demanding predatory cycle .

Current research indicates that the respiratory chain components, including nuoK, undergo differential regulation during the transition between free-living (attack phase) and intraperiplasmic growth phases of B. bacteriovorus. During the attack phase, when the bacterium exhibits high motility to locate prey, the respiratory chain operates at high capacity, with increased expression of components including nuoK. This enhanced respiratory activity supports the energetic demands of flagellar motility and prey-seeking behavior .

Once B. bacteriovorus enters its prey, the metabolic profile shifts, and the respiratory chain reconfigures to accommodate the nutrient-rich intraperiplasmic environment. Experimental evidence using deletion mutants of respiratory complex components has demonstrated reduced predation efficiency, with effects on:

These findings suggest that nuoK and other respiratory chain components are not merely housekeeping genes but are actively integrated into the specialized predatory lifestyle of B. bacteriovorus. The precise mechanism by which nuoK contributes to predation requires further investigation, particularly regarding potential interactions with predation-specific proteins and possible involvement in energy-dependent processes unique to predatory bacteria.

What functional differences exist between the NADH-quinone oxidoreductase complex in B. bacteriovorus and other bacteria?

The NADH-quinone oxidoreductase complex in B. bacteriovorus exhibits several notable differences compared to homologous complexes in other bacteria, particularly regarding subunit composition, ion specificity, and regulatory mechanisms.

Comparative genomic analyses suggest that the B. bacteriovorus complex evolved distinctive features aligned with its predatory lifestyle . Unlike the sodium-pumping NADH:ubiquinone oxidoreductase (Na+-NQR) found in many pathogenic bacteria such as Vibrio cholerae, the B. bacteriovorus complex appears to function primarily as a proton-pumping entity . This fundamental difference in ion specificity likely reflects adaptations to the unique membrane potential requirements during transitions between free-living and intraperiplasmic phases.

A comparison of key features between different bacterial NADH-quinone oxidoreductase complexes:

FeatureB. bacteriovorus ComplexNa+-NQR (e.g., in V. cholerae)Standard NDH-1 (E. coli)
Ion specificityPrimarily H+Na+H+
Subunit compositionContains nuoKLacks nuoK homologContains nuoK
CofactorsStandard Fe-S clustersContains flavins and Fe-SStandard Fe-S clusters
Evolutionary originDerived from standard NDH-1Evolved from RNF complexAncestral form
Regulatory patternsPredation-phase regulatedConstitutiveGrowth-phase regulated

The B. bacteriovorus complex also displays unique kinetic properties and inhibitor sensitivity profiles, suggesting structural adaptations that may enable it to function optimally in the varying environments encountered during predation. These functional differences make the B. bacteriovorus nuoK subunit particularly interesting for comparative structural biology and evolutionary studies of respiratory complexes.

How can nuoK be utilized in structural studies of the complete NADH-quinone oxidoreductase complex?

The nuoK subunit provides a valuable experimental handle for structural studies of the complete NADH-quinone oxidoreductase complex due to its integral membrane position and amenability to recombinant expression. Several methodological approaches leverage nuoK in structural investigations:

  • Cryo-electron microscopy (cryo-EM) studies: Recombinant nuoK with site-specific tags can serve as reference points for image processing and 3D reconstruction of the entire complex. This approach requires generating stable protein complexes where nuoK is incorporated into the native assembly, typically achieved through co-expression strategies or reconstitution from purified components.

  • Cross-linking coupled with mass spectrometry (XL-MS): By introducing chemical crosslinking reagents that target the exposed lysine residues in nuoK (including K107), researchers can identify interacting partners within the complex. This technique has proven particularly valuable for mapping transmembrane domain interactions that are challenging to resolve by other methods.

  • Site-directed spin labeling: Strategic introduction of cysteine residues into nuoK allows spin label attachment for electron paramagnetic resonance (EPR) spectroscopy. This approach provides information about the dynamic behavior of nuoK within the assembled complex and its conformational changes during the catalytic cycle.

  • Reconstitution experiments: Purified recombinant nuoK can be systematically reintroduced into subcomplexes lacking this subunit to assess its contribution to assembly, stability, and activity. This reconstitution approach has revealed that nuoK integration occurs at specific steps in the assembly pathway of the respiratory complex.

These approaches collectively contribute to understanding the structural organization of the complete complex, with nuoK serving as both an experimental tool and a subject of investigation. The recombinant expression systems for nuoK provide the quantities and molecular engineering possibilities needed for these sophisticated structural biology approaches .

What are the optimal conditions for expressing recombinant nuoK protein with maximum yield and proper folding?

Maximizing the yield and proper folding of recombinant nuoK protein requires careful optimization of multiple parameters. Based on current research protocols, the following represents an optimized expression approach:

  • Expression system selection:

    • E. coli strain: C41(DE3) or Lemo21(DE3) provide superior results for nuoK compared to standard BL21(DE3), showing 2-3 fold higher membrane integration

    • Expression vector: pET-based vectors with T7 promoter and optional fusion partners (SUMO tag has shown enhanced results)

    • Codon optimization: Adjusting codons for E. coli usage improves translation efficiency by approximately 30%

  • Culture conditions optimization:

    • Growth medium: Terrific Broth (TB) supplemented with 0.4% glycerol yields higher biomass

    • Temperature modulation: Growing cells at 37°C until OD600 0.6-0.8, then reducing to 18°C prior to induction

    • Induction parameters: 0.1-0.2 mM IPTG for 16-18 hours at 18°C provides optimal balance between expression level and proper membrane integration

  • Membrane fraction preparation:

    • Cell disruption: Sonication in short pulses (10s on/30s off) or single passage through French press at 15,000 psi

    • Differential centrifugation: Sequential centrifugation at 12,000g (15 min) to remove debris followed by 150,000g (1 hour) to isolate membrane fraction

    • Membrane storage: Flash-freezing in buffer containing 10% glycerol at -80°C maintains protein integrity

  • Solubilization optimization:

    • Detergent screening: n-dodecyl-β-D-maltoside (DDM) at 1% with gradual reduction to 0.05% during purification

    • Lipid supplementation: Addition of E. coli polar lipid extract (0.1 mg/mL) enhances protein stability

    • Buffer composition: 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 5% glycerol, 5 mM β-mercaptoethanol

This methodology typically yields 1-2 mg of purified nuoK protein per liter of culture with approximately 80% properly folded protein as assessed by circular dichroism spectroscopy . The addition of specific chaperones (GroEL/ES) as co-expression partners has shown further improvement in folding efficiency in some studies.

What experimental approaches can determine if recombinant nuoK integrates correctly into membrane systems?

Determining the correct membrane integration of recombinant nuoK requires multiple complementary experimental approaches that assess both structural aspects and functional characteristics:

  • Protease accessibility assays: This technique exploits the differential accessibility of protein regions to proteases depending on their membrane topology. The method involves:

    • Reconstituting purified nuoK into liposomes or nanodiscs

    • Treating with proteases like trypsin or chymotrypsin under controlled conditions

    • Analyzing the digestion pattern by SDS-PAGE and mass spectrometry

    • Comparing experimental results with theoretical cleavage patterns based on predicted topology models

  • Fluorescence-based approaches:

    • Site-specific labeling of nuoK with environment-sensitive fluorophores at positions predicted to be in different membrane environments

    • Measuring spectral shifts and quenching patterns that indicate the local environment (lipidic vs. aqueous)

    • Fluorescence resonance energy transfer (FRET) to determine distances between labeled positions and membrane surfaces

  • Electron microscopy validation:

    • Negative stain EM of reconstituted nuoK in nanodiscs to visualize membrane embedding

    • Immuno-gold labeling of specific epitopes or tags to confirm orientation

    • Cryo-EM of reconstituted complexes to assess structural integration at higher resolution

  • Functional reconstitution assays:

    • Incorporation of purified nuoK into proteoliposomes containing other subunits of the NADH-quinone oxidoreductase complex

    • Measurement of NADH oxidation rates and membrane potential generation

    • Comparison with native complex activity to assess functional integration

  • Molecular dynamics simulations:

    • In silico modeling of nuoK within lipid bilayers to predict stable conformations

    • Comparison of simulation results with experimental data to refine structural models

    • Identification of key lipid-protein interactions that stabilize the native conformation

These approaches collectively provide strong evidence for proper membrane integration when results converge on a consistent topology model. The lipid composition significantly impacts integration success, with a mixture of phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin most closely mimicking the native B. bacteriovorus membrane environment.

What analytical methods are most effective for studying the interactions between nuoK and other subunits of the NADH-quinone oxidoreductase complex?

Studying protein-protein interactions within membrane-bound complexes like NADH-quinone oxidoreductase requires specialized analytical approaches. For nuoK interactions with other subunits, the following methods have proven most informative:

  • Co-purification and pull-down assays:

    • Expression of His-tagged nuoK alongside other complex subunits

    • Sequential affinity chromatography to isolate intact subcomplexes

    • Western blot analysis to identify co-purifying partners

    • Quantitative assessment of binding stoichiometry through densitometry

  • Chemical cross-linking coupled with mass spectrometry (XL-MS):

    • Application of membrane-permeable crosslinking agents (e.g., DSS, BS3) to stabilize transient interactions

    • Enzymatic digestion of crosslinked complexes

    • LC-MS/MS analysis to identify crosslinked peptides

    • Computational modeling to generate distance restraints between subunits

  • Surface plasmon resonance (SPR) and microscale thermophoresis (MST):

    • Immobilization of purified nuoK in nanodiscs or detergent micelles on sensor surfaces

    • Measurement of real-time binding kinetics with other purified subunits

    • Determination of binding affinity constants and thermodynamic parameters

    • Evaluation of the effects of mutations on binding properties

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Monitoring deuterium incorporation rates in nuoK alone versus in complex with other subunits

    • Identification of regions with altered solvent accessibility upon complex formation

    • Mapping interaction interfaces with peptide-level resolution

    • Assessment of conformational changes induced by subunit binding

  • Native mass spectrometry:

    • Analysis of intact membrane protein complexes under native-like conditions

    • Determination of subunit stoichiometry and complex stability

    • Identification of subcomplexes formed during assembly or dissociation

    • Characterization of non-covalent interactions maintaining complex integrity

These analytical approaches have revealed that nuoK forms primary interactions with the adjacent membrane subunits (likely nuoA, nuoJ, and nuoN), contributing to the proton translocation pathway of the complex. The interaction interfaces are predominantly mediated by transmembrane helix-helix contacts involving conserved glycine residues that permit close helix packing. The strength of these interactions varies depending on the lipid environment, with certain phospholipids promoting more stable associations between nuoK and its binding partners.

How can nuoK research contribute to understanding the potential of Bdellovibrio bacteriovorus as a "living antibiotic"?

Research on nuoK provides critical insights into the energy metabolism of Bdellovibrio bacteriovorus, which directly impacts its potential applications as a "living antibiotic." This connection manifests through several research pathways:

  • Metabolic requirements during predation: The NADH-quinone oxidoreductase complex containing nuoK is essential for energy generation during the predatory lifecycle of B. bacteriovorus . Studies of nuoK function help elucidate how this predator maintains energy homeostasis while invading and consuming prey bacteria, particularly during transitions between attack phase and growth phase. This knowledge is fundamental to optimizing predation efficiency for therapeutic applications.

  • Target specificity mechanisms: By characterizing the energy requirements associated with prey recognition and invasion, nuoK research contributes to understanding the molecular basis of B. bacteriovorus host range. This information is crucial for developing B. bacteriovorus as a targeted antimicrobial against specific pathogens while minimizing effects on beneficial microbiota .

  • Environmental adaptation capabilities: The respiratory chain containing nuoK enables B. bacteriovorus to adapt to varying environments encountered during predation and in potential therapeutic contexts. Research examining how nuoK and the respiratory complex function under different conditions (oxygen levels, pH, ion concentrations) provides insights into the predator's robustness in therapeutic settings.

  • Genetic engineering targets: Understanding nuoK function can identify opportunities for genetic modification to enhance predatory capabilities. Engineered variants of B. bacteriovorus with optimized energy metabolism could potentially exhibit:

    • Improved predation efficiency against antibiotic-resistant bacteria

    • Extended survival in therapeutic environments

    • Enhanced resistance to host defense mechanisms

  • Biofilm eradication potential: B. bacteriovorus shows promise for disrupting bacterial biofilms, which are often resistant to conventional antibiotics . The energy-dependent processes required for penetrating and degrading biofilms involve the respiratory chain containing nuoK, making this research directly relevant to developing biofilm eradication strategies.

By integrating nuoK research with broader studies of B. bacteriovorus predatory mechanisms, researchers can advance the development of predatory bacteria as next-generation antimicrobial agents that could help address the growing crisis of antibiotic resistance .

What insights does the structure and function of nuoK provide for the evolutionary study of respiratory complexes?

The nuoK subunit offers valuable insights into the evolutionary history and diversity of respiratory complexes across bacterial lineages. Comparative analysis of this small but integral membrane component reveals important evolutionary patterns:

  • Evolutionary conservation and divergence: Despite considerable sequence divergence, the nuoK subunit maintains structural conservation across diverse bacterial phyla. This pattern suggests strong selective pressure on maintaining the three-dimensional arrangement of transmembrane helices while allowing sequence-level adaptations to different cellular environments. The B. bacteriovorus nuoK exhibits several unique residues compared to homologs in non-predatory bacteria, potentially reflecting adaptations to its predatory lifestyle .

  • Origin of respiratory complexes: Phylogenetic analysis of nuoK sequences supports the hypothesis that the NADH-quinone oxidoreductase complex evolved from a more primitive complex. The evolutionary relationship between different types of respiratory complexes (NDH-1, Na+-NQR) can be traced through nuoK and its homologs . Evidence suggests that the complex in B. bacteriovorus represents an interesting evolutionary intermediate between standard proton-pumping complexes and the specialized sodium-pumping variants found in some pathogens.

  • Operon organization and horizontal gene transfer: The genomic context of nuoK provides evidence for the role of horizontal gene transfer in the evolution of respiratory complexes. Comparative genomic analysis has revealed that the operon encoding nuoK and other subunits has undergone transfer events between different bacterial lineages . In Bdellovibrio, the acquisition and modification of this operon likely contributed to its adaptation to a predatory lifestyle.

  • Functional diversification: The nuoK subunit participates in ion translocation, and its structure reveals how minor sequence variations can alter ion specificity and coupling efficiency. By comparing nuoK from B. bacteriovorus with homologs from bacteria using different coupling ions (H+ vs. Na+), researchers can identify the molecular determinants of ion selectivity . This comparative approach has revealed that specific amino acid substitutions in transmembrane helices can fundamentally alter the bioenergetic properties of the entire respiratory complex.

  • Adaptation to ecological niches: The structure and properties of nuoK reflect adaptations to the unique ecological niche of B. bacteriovorus. Compared to homologs in free-living bacteria, the B. bacteriovorus nuoK exhibits features that likely support energy generation during predation. These adaptations illustrate how respiratory complexes have been modified throughout evolution to support diverse metabolic strategies and ecological roles.

This evolutionary perspective on nuoK provides a framework for understanding the remarkable diversity of respiratory complexes across the bacterial domain and illuminates the molecular mechanisms underlying bacterial adaptation to diverse energy sources and lifestyles.

What are the future research directions for nuoK and related proteins in Bdellovibrio bacteriovorus?

Future research on nuoK and related respiratory proteins in B. bacteriovorus is poised to expand in several promising directions that intersect with both basic science and applied research:

  • Structural biology advancements: The application of emerging structural techniques, particularly single-particle cryo-electron microscopy and integrative modeling approaches, will likely reveal the complete structure of the B. bacteriovorus NADH-quinone oxidoreductase complex at atomic resolution. This structural information will clarify nuoK's precise role within the complex and potentially reveal unique structural adaptations related to the predatory lifestyle .

  • Systems biology integration: Future research will likely place nuoK function within the broader context of predator-prey interactions using systems biology approaches. Multi-omics analyses (transcriptomics, proteomics, metabolomics) during predation will reveal how respiratory complexes are regulated in response to different prey bacteria and environmental conditions, with nuoK serving as an important model for studying membrane protein dynamics during predation.

  • Synthetic biology applications: The engineering of optimized B. bacteriovorus strains for antimicrobial applications represents a promising direction, with respiratory components including nuoK being potential targets for modification. Research may focus on enhancing energy efficiency or altering substrate specificity to improve predatory performance in specific therapeutic contexts .

  • Comparative bioenergetics: Expanded research comparing respiratory complexes across predatory and non-predatory bacteria will illuminate how these essential components have been adapted for different lifestyles. This comparative approach will likely include additional predatory bacteria beyond Bdellovibrio to establish broader evolutionary patterns.

  • Therapeutic development pipeline: As research on B. bacteriovorus as a "living antibiotic" advances toward clinical applications, understanding energy metabolism through nuoK and related proteins will be crucial for optimizing therapeutic efficacy . This will include studies of metabolic requirements in relevant host environments and the development of genetic engineering strategies to enhance survival and predatory activity.

  • Biotechnological applications beyond antimicrobials: The unique properties of B. bacteriovorus proteins, including components of the respiratory chain, may find applications in biotechnology beyond antimicrobial therapy. Potential areas include bioremediation, protein engineering platforms, and the development of novel bioenergetic systems for synthetic biology applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.