Recombinant Bdellovibrio phage phiMH2K Uncharacterized protein N (ORFN)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us beforehand, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ORFN; Uncharacterized protein N
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Bdellovibrio phage phiMH2K (Bacteriophage phiMH2K)
Target Names
ORFN
Target Protein Sequence
METKPNALTGTSLSSTSGQTTQKSITLQNSENKYIPQNSSETFGLMAILNLALLLWTLLA TLRVTLQKNWPTETTKTTTITQFTTLQKNTPSAKNGLKNTTNKHSHEDM
Uniprot No.

Target Background

Database Links

KEGG: vg:918750

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is Bdellovibrio phage phiMH2K and its ORFN protein?

Bdellovibrio phage phiMH2K is a novel single-stranded DNA bacteriophage that infects Bdellovibrio bacteriovorus, a predatory bacterium. The phage belongs to the Microviridae family, characterized by icosahedral virions containing single-stranded DNA genomes . PhiMH2K has been fully sequenced and characterized, revealing its genome organization and encoded proteins.

ORFN (Open Reading Frame N) is one of the proteins encoded by the phiMH2K genome. It remains classified as "uncharacterized," meaning its precise function is currently unknown. The full-length protein consists of 109 amino acids with the sequence: "METKPNALTGTSLSSTSGQTTQKSITLQNSENKYIPQNSSETFGLMAILNLALLLWTLLATLRVTLQKNWPTETTKTTTITQFTTLQKNTPSAKNGLKNTTNKHSHEDM" .

To approach the characterization of such proteins, researchers typically begin with sequence analysis using tools like BLAST, Pfam, and InterPro to identify conserved domains or sequence similarities to proteins of known function. This is followed by structural prediction using tools like AlphaFold or RoseTTAFold, and experimental characterization through expression, purification, and functional assays.

How does phiMH2K relate to other bacteriophages in the Microviridae family?

PhiMH2K exhibits an unexpected evolutionary relationship within the Microviridae family. Despite infecting Bdellovibrio bacteriovorus (a proteobacterium), phiMH2K is more closely related to Microviridae phages that infect Chlamydia than to those that infect other proteobacteria like Escherichia coli (e.g., phiX174) . This is evident in both genome organization and encoded proteins.

This surprising relationship suggests that single-stranded DNA bacteriophages may follow different evolutionary trajectories compared to double-stranded DNA bacteriophages. While double-stranded DNA phages show a wide spectrum of diversity, single-stranded icosahedral bacteriophages appear to cluster into two distinct subfamilies . These observations indicate that the mechanisms driving single-stranded DNA bacteriophage evolution may be inherently different from those driving double-stranded bacteriophage evolution.

For investigating such evolutionary relationships, researchers should employ phylogenetic analysis methods that account for the rapid evolution rates typical of viral genomes. Multiple sequence alignment tools like MUSCLE or MAFFT, followed by phylogenetic tree construction using maximum likelihood or Bayesian methods, can elucidate evolutionary relationships. Additionally, whole-genome synteny analysis can provide insights into conservation of gene order and content across related phages.

What expression systems are suitable for recombinant ORFN protein production?

For basic studies requiring high yields, E. coli remains the most cost-effective and efficient system. Specifically:

Expression SystemAdvantagesLimitationsBest For
E. coli BL21(DE3)High yield, low cost, rapid growthLimited post-translational modificationsInitial characterization, structural studies
Insect cells (Sf9)Better folding, post-translational modificationsHigher cost, slower productionFunctional studies requiring authentic folding
Yeast (P. pastoris)Secretion, high density culturesGlycosylation patterns differ from mammalianScale-up production
Cell-free systemsRapid, works with toxic proteinsLimited scale, higher costQuick screening of constructs

For ORFN protein specifically, optimal expression in E. coli can be achieved using:

  • BL21(DE3) or its derivatives for high-level expression

  • pET vector systems with T7 promoters for tight control of expression

  • Induction at lower temperatures (16-25°C) to reduce inclusion body formation

  • Addition of solubility-enhancing tags (SUMO, MBP, GST) if needed

The recombinant ORFN protein currently available is produced in E. coli with a His-tag, suggesting this system provides adequate yield and quality for research purposes .

What are the optimal conditions for functional studies of recombinant phiMH2K ORFN protein?

Functional studies of uncharacterized proteins like ORFN require careful optimization of experimental conditions. Based on information about similar phage proteins and standard practices for recombinant protein work:

Buffer Optimization:

  • Test multiple buffers (Tris, HEPES, phosphate) at pH ranges 6.5-8.0

  • Include stabilizing agents (5-10% glycerol, 1-5 mM DTT or β-mercaptoethanol)

  • Optimize salt concentration (typically 50-300 mM NaCl)

  • Consider adding metal ions (Mg²⁺, Zn²⁺, Ca²⁺) that might be cofactors

Functional Assay Design:
The choice of functional assays should be guided by hypotheses about potential functions, which might include:

Potential FunctionAppropriate AssaysKey Parameters
DNA/RNA bindingEMSA, filter binding, fluorescence anisotropypH, salt concentration, nucleic acid length/sequence
Protein-protein interactionsPull-down, SPR, ITC, Y2HBuffer composition, detergent concentration
Membrane interactionLiposome binding, membrane flotationLipid composition, protein:lipid ratio
Enzymatic activitySubstrate conversion assaysSubstrate concentration, cofactors, temperature

For the recombinant His-tagged ORFN protein, storage buffer information indicates use of a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . This provides a starting point for functional studies, which can be optimized based on specific assay requirements. For reconstitution, the protein is recommended to be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL with addition of 5-50% glycerol for long-term storage .

How can one analyze the evolutionary relationship between phiMH2K ORFN and similar proteins in Chlamydia?

The close relationship between phiMH2K and Chlamydial Microviridae presents an intriguing evolutionary puzzle, especially since B. bacteriovorus and Escherichia coli are both classified as proteobacteria, yet phiMH2K is only distantly related to phiX174 . To investigate this relationship specifically for the ORFN protein:

Sequence-Based Approaches:

  • Perform BLAST searches against protein databases with varying sensitivity parameters

  • Conduct Position-Specific Iterated BLAST (PSI-BLAST) to detect remote homologs

  • Use Hidden Markov Models (HMMs) to identify distant relationships

  • Apply profile-profile comparison methods for even more sensitive detection

Phylogenetic Analysis Protocol:

StepMethodPurposeTools
1. Sequence retrievalDatabase miningCollect all related sequencesNCBI, UniProt
2. Multiple sequence alignmentProgressive alignmentEstablish homologous positionsMUSCLE, MAFFT
3. Alignment curationManual/automated trimmingRemove ambiguous regionsGBLOCKS, TrimAl
4. Model selectionStatistical testingIdentify best evolutionary modelModelTest, ProtTest
5. Tree constructionMaximum likelihoodInfer evolutionary relationshipsRAxML, IQ-TREE
6. Tree evaluationBootstrap analysisAssess confidence in branches1000+ replicates

Genomic Context Analysis:

  • Examine the position of ORFN in the phiMH2K genome relative to other genes

  • Compare with the genomic organization of Chlamydial phages

  • Look for conserved gene neighborhoods that might suggest functional relationships

This comprehensive approach can help determine whether the similarity between phiMH2K and Chlamydial phages is due to horizontal gene transfer, convergent evolution, or shared ancestry, which may challenge conventional understanding of bacteriophage evolution .

What are the challenges in determining the function of uncharacterized proteins like ORFN?

Determining the function of uncharacterized proteins like ORFN presents several methodological challenges:

Limited Sequence Homology:

  • Few close homologs with known function

  • Rapid evolution of viral proteins obscuring relationships

  • Potential novel folds or functions not represented in databases

Functional Redundancy and Context-Dependence:

  • Multiple proteins may perform similar functions in different phages

  • Function may require specific host factors or other phage proteins

  • Activity might be condition-specific or triggered by particular stimuli

Technical Limitations:

  • Difficulty in expressing and purifying functional protein

  • Protein may require post-translational modifications

  • Challenges in designing appropriate activity assays without functional hints

Methodological Approaches to Overcome These Challenges:

ChallengeStrategyExample Techniques
Limited homologySensitive sequence analysisProfile HMMs, remote homology detection
Unknown functionHigh-throughput screeningActivity-based protein profiling, phage display
Context-dependenceIn vivo studiesGenetic complementation, host-range analysis
Technical difficultiesOptimized expressionFusion tags, chaperone co-expression

Researchers should design experiments that can test multiple hypotheses simultaneously and remain open to unexpected functions that may not be evident from sequence analysis alone. The close relationship between phiMH2K and Chlamydial phages despite differences in host organisms suggests potential functional convergence or horizontal transfer that adds complexity to functional determination .

How does ORFN protein potentially contribute to phage-host interactions?

While the specific function of ORFN remains uncharacterized, several lines of evidence can guide hypotheses about its potential role in phage-host interactions:

Sequence-Based Predictions:
The presence of potential transmembrane domains in the ORFN sequence (LLLWTLLA motif) suggests it might interact with membranes . This could indicate roles in:

  • Host cell attachment or penetration

  • Interference with host membrane proteins

  • Formation of membrane pores for DNA translocation

  • Modification of host cell envelope properties

Comparative Analysis:
By examining the evolutionary relationship between phiMH2K and Chlamydial phages, researchers can generate hypotheses about ORFN function based on the biological constraints faced by phages infecting phylogenetically diverse hosts . Potential roles might include:

  • Adaptation to specific host cell receptors

  • Overcoming host defense mechanisms

  • Specialized DNA replication mechanisms

  • Host metabolism manipulation

Experimental Approaches to Test These Hypotheses:

ApproachMethodExpected Outcome
LocalizationFluorescence microscopyCellular compartment where ORFN functions
Interaction partnersCo-immunoprecipitation, crosslinkingHost or phage proteins that interact with ORFN
Deletion analysisPhage mutants lacking functional ORFNEffect on phage replication cycle
Host rangeInfection of various Bdellovibrio strainsCorrelation between ORFN sequence and host specificity

Understanding how ORFN contributes to phage-host interactions could provide insights into bacterial predation mechanisms and potentially inform studies of phage therapy or novel antimicrobial strategies.

What purification strategies yield the highest purity for recombinant phiMH2K ORFN protein?

Purifying recombinant ORFN protein to high homogeneity requires a well-designed purification strategy. Based on the His-tagged construct described in the available information :

Primary Purification (Affinity Chromatography):

  • Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA or Co-NTA resin

  • Optimize imidazole concentration in binding buffer (10-20 mM) to reduce non-specific binding

  • Use gradient elution (50-300 mM imidazole) for better separation

  • Consider on-column refolding if protein is in inclusion bodies

Secondary Purification (Polishing Steps):

  • Size Exclusion Chromatography (SEC) to separate monomeric protein from aggregates

  • Ion Exchange Chromatography based on predicted isoelectric point

  • Hydrophobic Interaction Chromatography if the protein has hydrophobic patches

Purification Quality Assessment:

  • SDS-PAGE with Coomassie staining (aim for >90% purity as indicated in product specifications)

  • Western blot against His-tag

  • Mass spectrometry for accurate mass determination

  • Dynamic Light Scattering for monodispersity analysis

A typical purification workflow might look like this:

Purification StepExpected PurityYield (% of starting)Key Optimization Parameters
Crude lysate1-5%100%Lysis buffer composition, cell disruption method
IMAC (Ni-NTA)70-85%50-70%Imidazole concentration, binding time
SEC>95%30-50%Buffer composition, flow rate
Concentration>95%25-45%Membrane selection, centrifugation speed

For membrane-associated proteins like ORFN (which contains a potential transmembrane domain), consider:

  • Adding mild detergents (0.1% DDM, 0.5% CHAPS) to extraction and purification buffers

  • Using arginine (50-100 mM) to improve solubility

  • Testing different E. coli strains optimized for membrane protein expression

  • Employing solubility-enhancing fusion tags (MBP, SUMO) with appropriate cleavage sites

How can structural studies be designed to elucidate the function of ORFN?

Structural studies can provide valuable insights into the potential function of uncharacterized proteins like ORFN. A comprehensive structural biology approach would include:

X-ray Crystallography Approach:

  • Protein construct optimization

    • Test multiple truncations based on secondary structure predictions

    • Remove flexible regions that might impede crystallization

    • Consider surface entropy reduction mutations

  • Crystallization screening

    • Commercial sparse matrix screens (>1000 conditions)

    • Optimization of promising conditions (pH, precipitant concentration, additives)

  • Data collection and structure determination

    • Consider heavy atom derivatives if molecular replacement is not possible

    • Use synchrotron radiation for high-resolution data

NMR Spectroscopy Approach:

  • Express ¹⁵N and ¹³C labeled protein

  • Collect 2D and 3D spectra for backbone and side-chain assignments

  • Generate distance restraints from NOE experiments

  • Perform binding studies with potential ligands or interaction partners

Structure-Function Analysis:

  • Identify potential active sites or binding pockets

  • Generate structure-guided mutations of key residues

  • Test mutants in functional assays

  • Perform computational docking with potential ligands

A decision matrix for selecting the appropriate structural method:

MethodAdvantagesLimitationsBest For
X-ray CrystallographyHigh resolution (potentially <1.5Å)Requires crystalsDetailed active site analysis
NMR SpectroscopySolution structure, dynamics informationSize limitation (~30 kDa)Studying protein-ligand interactions
Cryo-EMNo size limitation, can visualize complexesLower resolution for small proteinsStructural context in larger assemblies
Computational PredictionRapid, no experimental limitationsLess accurate than experimental methodsInitial hypothesis generation

For ORFN, which is a relatively small protein (109 amino acids) , both X-ray crystallography and NMR spectroscopy are viable approaches. Initial computational structure prediction can guide construct design and experimental planning before committing to resource-intensive structural studies.

What are the optimal storage conditions for maintaining ORFN protein stability?

Based on the information provided for the recombinant ORFN protein, and general principles of protein stability:

Short-term Storage (1-2 weeks):
The product information specifically states: "Store working aliquots at 4°C for up to one week" . This is consistent with general protein storage recommendations for frequent use.

Long-term Storage:
The manufacturer recommends storing the protein at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles . The specific storage buffer is Tris/PBS-based with 6% Trehalose at pH 8.0 .

Reconstitution and Storage Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (manufacturer's default is 50%)

  • Aliquot to avoid repeated freeze-thaw cycles

  • Store aliquots at -20°C/-80°C for long-term storage

Stability Assessment Methods:

MethodParameter MeasuredEquipment RequiredFrequency
SDS-PAGEDegradationGel electrophoresis systemBefore each experiment series
SEC-HPLCAggregationHPLC system with SEC columnMonthly for long-term storage
DLSParticle size distributionDynamic light scattering deviceBefore critical experiments
Activity assayFunctional integrityVaries by assayBefore each critical experiment

These recommendations are consistent with best practices for recombinant protein storage and specifically tailored to the ORFN protein specifications provided by the manufacturer .

What are recommended protocols for reconstitution of lyophilized ORFN protein?

According to the product information, the recombinant ORFN protein is supplied as a lyophilized powder . Proper reconstitution is crucial for maintaining protein activity and solubility:

Standard Reconstitution Protocol:
The manufacturer provides specific instructions for reconstitution:

  • Centrifuge the vial briefly prior to opening to bring the contents to the bottom

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% of glycerol (final concentration) and aliquot for long-term storage

  • The manufacturer's default final concentration of glycerol is 50%

Critical Considerations:

  • Temperature: Reconstitute on ice to minimize protein denaturation

  • Mixing: Gentle swirling or inversion rather than vortexing to avoid denaturation

  • Concentration: Higher concentrations may lead to aggregation, especially for proteins with hydrophobic domains like ORFN

  • Additives: The storage buffer (Tris/PBS-based buffer, 6% Trehalose, pH 8.0) already contains stabilizing agents

Troubleshooting Common Reconstitution Issues:

IssuePotential CausesSolutions
Insoluble proteinToo high concentration, improper bufferReduce concentration, optimize buffer composition
Protein aggregationRapid rehydration, improper pHReconstitute slowly, adjust pH
Loss of activityDenaturation during reconstitutionReconstitute at lower temperature, add stabilizers
Precipitation upon thawingFreeze-thaw damageAdd cryoprotectants, avoid freeze-thaw cycles

Verification of Successful Reconstitution:

  • Visual inspection for clarity (absence of visible particulates)

  • Measurement of protein concentration (Bradford or BCA assay)

  • Dynamic light scattering to assess aggregation state

  • SDS-PAGE to confirm expected molecular weight and purity (should be greater than 90% as determined by SDS-PAGE according to product specifications)

Following these guidelines should ensure optimal reconstitution of the lyophilized ORFN protein for subsequent experimental use.

How should researchers interpret sequence homology data for uncharacterized proteins like ORFN?

Interpreting sequence homology for uncharacterized proteins requires careful analysis and consideration of multiple factors:

Levels of Sequence Homology Significance:

Sequence IdentityInterpretationFunctional Inference Reliability
>40%High confidence homologyFunction likely conserved
25-40%Moderate confidenceCore function may be conserved, specific activity may differ
15-25%Twilight zoneStructural similarity likely, functional similarity possible
<15%Midnight zoneStructural similarity possible, functional inference unreliable

Methodological Approach to Homology Interpretation:

Context-Dependent Analysis:
For ORFN specifically, its relationship to proteins in Chlamydial phages despite host differences suggests complex evolutionary history . This requires contextual analysis:

  • Consider genomic context and gene neighborhood

  • Examine conservation of key residues in potential active sites

  • Look for domain architecture conservation

  • Consider taxonomic distribution of homologs

For phiMH2K, the fact that it shows closer relationship to Chlamydial Microviridae than to phiX174 (despite B. bacteriovorus and E. coli both being proteobacteria) indicates that standard phylogenetic assumptions may not apply . This unusual relationship suggests that researchers should be particularly cautious when making functional inferences based solely on sequence homology.

What bioinformatic approaches can predict potential functions of ORFN?

Predicting functions for uncharacterized proteins like ORFN requires an integrative bioinformatics approach:

Sequence-Based Prediction Methods:

  • Conserved domain identification (CDD, Pfam, InterPro)

  • Motif scanning (PROSITE, ELM)

  • Secondary structure prediction (PSIPRED, JPred)

  • Transmembrane domain prediction (TMHMM, Phobius) - particularly relevant given the potential transmembrane domain in ORFN

  • Signal peptide prediction (SignalP)

  • Disorder prediction (DISOPRED, IUPred)

Structure-Based Prediction Methods:

  • Fold recognition (threading) (Phyre2, I-TASSER)

  • Ab initio structure prediction (AlphaFold2, RoseTTAFold)

  • Binding site prediction (CASTp, SiteMap)

  • Electrostatic surface analysis

  • Structural classification (CATH, SCOP)

Systems Biology Approaches:
The close relationship between phiMH2K and Chlamydial phages suggests that systems-level approaches may be particularly valuable:

  • Gene neighborhood analysis

  • Protein-protein interaction prediction

  • Co-evolution analysis (direct coupling analysis)

  • Comparative genomics across phages with diverse hosts

Integrated Prediction Workflow:

Analysis StepToolsExpected Outcome
Basic sequence analysisBLAST, CD-SearchInitial homologs, domain identification
Advanced sequence analysisHHpred, HMMERRemote homologs, family membership
Structural predictionAlphaFold2, RoseTTAFold3D structural model
Structural comparisonDali, TM-alignStructural neighbors
Binding site analysisCASTp, ProBiSPotential functional sites
Function predictionDeepFRI, COFACTORGO terms, potential biochemical activities

For ORFN, combining these approaches can help develop testable hypotheses about its function in the phage life cycle or host interaction, particularly considering its relationship to Chlamydial phage proteins despite differences in host organisms .

How can researchers resolve contradictory results in ORFN functional studies?

When facing contradictory results in functional studies of uncharacterized proteins like ORFN, a systematic approach to resolution is essential:

Sources of Experimental Contradictions:

  • Differences in protein constructs (tags, truncations)

  • Variations in expression systems

  • Differences in purification methods

  • Assay-specific artifacts

  • Buffer and reaction condition differences

  • Context-dependent protein functions

Resolution Strategies:

1. Controlled Comparative Studies:

  • Replicate contradictory experiments using identical protocols

  • Systematically vary one condition at a time

  • Use multiple, complementary assay methods

  • Perform experiments in different laboratories (collaborative validation)

2. Technical Validation:

  • Verify protein identity by mass spectrometry

  • Confirm correct folding by circular dichroism

  • Validate activity of positive controls

  • Test for interfering contaminants

3. Biological Context Considerations:
This is particularly important for ORFN given the unusual evolutionary relationship between phiMH2K and other phages :

  • Test function in native versus heterologous systems

  • Examine dependence on cofactors or binding partners

  • Consider host-specific factors

  • Evaluate oligomerization state

Decision Matrix for Resolving Contradictions:

Contradiction TypeInvestigation ApproachExpected Outcome
Activity present/absentVary buffer conditions, test cofactorsIdentification of required conditions
Binding partner discrepanciesCross-validation with multiple methods (Y2H, CoIP, SPR)Confirmation of genuine interactions
Localization differencesLive cell imaging with multiple tags, fixed cell immunofluorescenceResolution of genuine localization
Phenotypic variationsGenetic complementation, dose-response studiesUnderstanding of threshold effects

For ORFN specifically, contradictions might arise from its uncharacterized nature and potential membrane association . Resolving these would require careful examination of experimental conditions, protein preparation methods, and the specific assays used to detect activity or interactions.

What statistical methods are appropriate for analyzing ORFN protein-protein interaction data?

Protein-protein interaction (PPI) studies generate complex data requiring appropriate statistical analysis:

Common PPI Detection Methods and Their Statistical Considerations:

MethodData TypeAppropriate Statistical Approaches
Yeast Two-HybridBinary interaction dataFisher's exact test, False discovery rate control
Co-ImmunoprecipitationSemi-quantitative western blot dataStudent's t-test, ANOVA for multiple conditions
Surface Plasmon ResonanceBinding kinetics (kon, koff, KD)Non-linear regression, Residual analysis
Isothermal Titration CalorimetryThermodynamic parametersNon-linear regression, Bootstrap error estimation
Proximity LabelingMass spectrometry quantificationSAINT algorithm, Fold-change analysis

General Statistical Framework for PPI Analysis:

1. Data Quality Assessment:

  • Outlier detection (Z-score, Grubb's test)

  • Normality testing (Shapiro-Wilk, Q-Q plots)

  • Variance homogeneity (Levene's test)

2. Significance Testing:

  • Parametric tests (t-test, ANOVA) for normally distributed data

  • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) for non-normal data

  • Multiple testing correction (Bonferroni, Benjamini-Hochberg FDR)

3. Specialized Analyses for Phage Protein Interactions:
When studying interactions between phage proteins like ORFN and host proteins, additional considerations include:

  • Host specificity analysis (comparing interaction profiles across multiple hosts)

  • Evolutionary conservation of interactions (particularly relevant given phiMH2K's relationship to Chlamydial phages)

  • Temporal analysis of interactions during infection cycle

  • Competition assays to validate specificity

4. Network Analysis:

  • Centrality measures (degree, betweenness, closeness)

  • Cluster coefficient calculation

  • Random network comparison for significance testing

  • Network visualization and community detection

For ORFN protein interactions, the statistical approach should match the experimental method and account for the uncharacterized nature of the protein. Initial studies might focus on establishing reproducible interactions with high statistical confidence before moving to more complex network analyses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.