Recombinant Bear canyon virus Pre-glycoprotein polyprotein GP complex (GPC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
250-483
Protein Length
Full Length of Mature Protein
Species
Bear Canyon mammarenavirus (isolate Mouse/United States/AV A0070039/2000) (BCNV)
Target Names
GPC
Target Protein Sequence
NFFSWSLVDSAGNSMPGGYCLEKWMLVASELKCFGNTAVAKCNINHDSEFCDMLRLFDYN KKAIVNLQDKTKAQLDSLIDAVNSLISDNLITKNKIRELMNIPYCNYTKFWYVNHTGLNV HSLPKCWHVRNGSYLNESDFRNEWIIESDHLVSEILAKEYEERQKRTPLSLVDLCFWSTL FYTASIFLHLLHIPTHRHIIGEGCPKPHRLTSDSLCACGFFQLKGRPTRWARIP
Uniprot No.

Target Background

Function

The Bear Canyon virus pre-glycoprotein polyprotein GP complex (GPC) is a class I viral fusion protein. It facilitates fusion between viral and host endosomal membranes, enabling nucleocapsid delivery into the cytoplasm. This membrane fusion is triggered by irreversible conformational changes induced by endosomal acidification. The stable signal peptide (SSP) is cleaved, functioning as a signal peptide and remaining as a component of the GP complex. The SSP is crucial for efficient glycoprotein expression, post-translational maturation (GP1 and GP2 cleavage), glycoprotein transport to the cell surface, infectious virion formation, and acid pH-dependent cell fusion mediated by the glycoprotein. The GPC also interacts with the host receptor.

Database Links

KEGG: vg:5848384

Protein Families
Arenaviridae GPC protein family
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the Bear Canyon virus glycoprotein complex?

The Bear Canyon virus (BCNV) glycoprotein complex (GPC) consists of three main components: a stable signal peptide (SSP), a receptor-binding glycoprotein (GP1), and a transmembrane fusion glycoprotein (GP2). Together, these form a trimeric complex on the viral envelope surface that orchestrates host-cell entry and serves as a key target of immune responses . Similar to other New World arenaviruses, each BCNV GPC protomer is initially synthesized as a pre-glycoprotein polyprotein that undergoes post-translational processing to yield the mature components. The SSP, unusually retained in the mature complex, is essential for proper GPC folding, trafficking, and membrane fusion activity .

What is known about the functional domains of BCNV GPC?

Based on studies of related arenaviruses, the BCNV GPC likely contains several functional domains essential for viral entry:

  • SSP Domain: Contains conserved residues involved in GPC maturation, trafficking, and membrane fusion regulation. Key residues likely include conserved N-terminal myristoylation sites and charged residues in the C-terminal domain that interact with GP2 .

  • GP1 Domain: Contains the receptor-binding region that determines cellular tropism. For New World arenaviruses, this typically interacts with transferrin receptor 1 (TfR1) .

  • GP2 Domain: Contains elements required for membrane fusion, including a fusion peptide, two heptad repeats, and a transmembrane domain. The heptad repeats form a six-helix bundle during the fusion process .

Comparative studies of Pichinde virus indicate that specific residues in the SSP (such as N20, N37, and R55) are critical for membrane fusion activity and viral virulence, suggesting similar residues may be important in BCNV GPC function .

What expression systems are optimal for producing recombinant BCNV GPC?

For research applications requiring recombinant BCNV GPC, several expression systems can be considered:

  • Mammalian Expression Systems: Human embryonic kidney (HEK293T) cells or Chinese hamster ovary (CHO) cells are preferred for full-length GPC expression to ensure proper glycosylation and processing. These systems allow for the study of authentic GPC maturation processes, including signal peptidase and subtilisin kexin isozyme-1/site-1 protease (SKI-1/S1P) processing.

  • Insect Cell Systems: Baculovirus expression in Sf9 or Hi5 cells can yield higher protein quantities while maintaining most post-translational modifications, though glycosylation patterns will differ from mammalian cells.

  • Bacterial Systems: While not suitable for full-length GPC due to glycosylation requirements, E. coli expression can be used for specific domains such as the ectodomain of GP2 or certain regions of GP1 for structural studies.

For structural studies of GP1-GP2 interactions, engineering approaches similar to those used for JUNV and MACV might be necessary, such as introducing disulfide bonds at the GP1-GP2 interface to stabilize the otherwise metastable interaction .

What purification challenges are specific to BCNV GPC, and how can they be overcome?

Purification of recombinant BCNV GPC presents several challenges:

  • Membrane Protein Extraction: As GPC is a membrane protein complex, effective detergent selection is critical. For initial extraction, stronger detergents like Triton X-100 or NP-40 can be used, with subsequent exchange to milder detergents such as DDM or LMNG for stability during purification.

  • Metastability of GP1-GP2 Interaction: As observed with other New World arenaviruses, the GP1-GP2 interaction is likely metastable, which complicates purification of the intact complex. Stabilization strategies include:

    • Engineering intersubunit disulfide bonds (as demonstrated for JUNV and MACV)

    • Using pH conditions that minimize dissociation (typically pH 7.0-7.5)

    • Addition of stabilizing agents like glycerol or specific lipids

  • Glycosylation Heterogeneity: The presence of multiple glycosylation sites can lead to sample heterogeneity. Approaches to address this include:

    • Expression in GnTI- cell lines that produce more homogeneous high-mannose glycans

    • Enzymatic deglycosylation using EndoH or PNGase F

    • Site-directed mutagenesis to remove non-essential glycosylation sites

  • SSP Association: Ensuring retention of the SSP during purification may require additional strategies such as engineering covalent linkages or co-expression systems with tagged components.

A typical purification workflow might include affinity chromatography (using a C-terminal tag that doesn't interfere with SSP interactions), followed by size exclusion chromatography to isolate the trimeric complex.

What methods are effective for assessing the quality and functionality of purified recombinant BCNV GPC?

Several analytical approaches can assess the quality and functionality of purified recombinant BCNV GPC:

  • Structural Integrity Assessment:

    • SDS-PAGE and Western blotting to verify the presence of all three components (SSP, GP1, GP2)

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to confirm the oligomeric state

    • Negative-stain electron microscopy to visualize the trimeric complex

    • Circular dichroism spectroscopy to evaluate secondary structure content

  • Functional Analysis:

    • Cell-binding assays to assess GP1 receptor-binding capacity

    • pH-dependent conformational change assays using intrinsic tryptophan fluorescence or ANS binding

    • In vitro membrane fusion assays using liposome systems

    • Pseudotyped virus entry assays using vesicular stomatitis virus (VSV) or lentiviral vectors bearing BCNV GPC

  • Antigenic Characterization:

    • ELISA with conformational antibodies

    • Surface plasmon resonance to measure antibody-binding kinetics

    • Flow cytometry to assess cell-surface expression and antibody accessibility

Properly folded and functional BCNV GPC should maintain the ability to undergo pH-dependent conformational changes typical of arenavirus entry mechanisms and should bind to relevant receptors and neutralizing antibodies.

Which GPC residues are critical for BCNV viral entry and how can they be experimentally identified?

Based on studies of related arenaviruses, several regions of BCNV GPC likely contain residues critical for viral entry. To identify these residues experimentally:

  • Alanine Scanning Mutagenesis: Systematically substituting conserved residues with alanine can identify functionally important amino acids. Focus areas should include:

    • Conserved residues in the SSP, particularly N-terminal residues (residue 20), the central hydrophobic domain, and charged C-terminal residues (residues like N37 and R55)

    • The receptor-binding domain in GP1

    • The fusion peptide and heptad repeat regions in GP2

  • Reverse Genetics Approach: Using a reverse genetics system similar to that developed for Pichinde virus would allow evaluation of mutations in the context of infectious virus . This approach can assess effects on:

    • Viral entry efficiency

    • Membrane fusion activity

    • Viral growth in cell culture

    • Virulence in appropriate animal models

  • Pseudotyped Virus System: VSV or lentiviral pseudotypes bearing mutant BCNV GPC can provide a safer and more high-throughput system to screen for entry defects before moving to infectious virus models.

Studies with Pichinde virus have demonstrated that mutations like N20A in the SSP significantly reduce membrane fusion activity and viral virulence in guinea pigs while having minimal effects on cell entry, suggesting residues may have context-dependent functions in vitro versus in vivo .

How do post-translational modifications affect BCNV GPC function, and what methodologies can investigate these effects?

Post-translational modifications (PTMs) of BCNV GPC likely play crucial roles in protein folding, trafficking, and function. Key methodologies to investigate these effects include:

  • N-linked Glycosylation:

    • Site-directed mutagenesis of predicted N-glycosylation sites (Asn-X-Ser/Thr motifs)

    • Lectin blotting to characterize glycan structures

    • Mass spectrometry to map occupied glycosylation sites

    • Inhibitors like tunicamycin or expression in glycosylation-deficient cell lines

    • Assessing effects on folding, trafficking (using fluorescence microscopy), and function (using entry assays)

  • Myristoylation:

    • The SSP likely contains an N-terminal myristoylation site critical for membrane association

    • Mutation of the predicted myristoylation site (typically a glycine at position 2)

    • Metabolic labeling with alkyne-myristate analogs and click chemistry detection

    • Myristoylation inhibitors like 2-hydroxymyristic acid

  • Proteolytic Processing:

    • Site-directed mutagenesis of the GP1-GP2 cleavage site

    • Pulse-chase experiments to track processing kinetics

    • SKI-1/S1P inhibitors to block processing

    • Western blotting to monitor cleavage efficiency

  • Disulfide Bond Formation:

    • Mutation of conserved cysteine residues

    • Non-reducing SDS-PAGE to assess disulfide bond formation

    • Mass spectrometry to map disulfide connectivity

    • Thiol-modifying reagents to disrupt existing bonds

Research with related arenaviruses suggests that SSP myristoylation and specific glycosylation sites are likely critical for BCNV GPC maturation and function, while proteolytic processing by SKI-1/S1P is essential for activation of fusion potential.

What mechanisms underlie pH-dependent conformational changes in BCNV GPC, and how can they be experimentally probed?

Arenavirus entry typically involves pH-dependent conformational changes that trigger membrane fusion. For BCNV GPC, these mechanisms can be investigated through:

  • Identification of pH-sensing residues:

    • Alanine scanning or histidine substitution mutagenesis of candidate residues (particularly in GP2 and the SSP-GP2 interface)

    • pH titration experiments with wildtype and mutant proteins

    • Molecular dynamics simulations to predict protonation-induced conformational changes

  • Monitoring conformational changes:

    • Intrinsic tryptophan fluorescence to detect exposure of hydrophobic domains

    • Bis-ANS binding to detect exposure of hydrophobic surfaces

    • Protease sensitivity assays at varying pH values

    • Hydrogen-deuterium exchange mass spectrometry to map pH-dependent structural changes

    • Single-molecule FRET to detect real-time conformational dynamics

  • Functional correlation:

    • Cell-cell fusion assays using GPC-expressing cells exposed to varying pH

    • Liposome fusion assays with purified GPC at different pH values

    • Endosomal acidification inhibitors (bafilomycin A1, ammonium chloride) in infection assays

  • Structural approaches:

    • Cryo-EM of GPC at neutral and acidic pH

    • X-ray crystallography of pre-fusion and post-fusion conformations (likely requiring stabilizing mutations)

Research on other arenaviruses suggests that interactions between the SSP and GP2 are particularly important for pH sensing, with the SSP playing a role in regulating the pH threshold for fusion activation, a mechanism that could be therapeutically targeted .

How does BCNV GPC differ structurally and functionally from Old World versus New World arenaviruses?

BCNV belongs to the New World (NW) arenaviruses of the Tacaribe serocomplex, and its GPC likely exhibits both shared features and key differences compared to Old World (OW) arenaviruses:

  • Receptor Usage:

    • NW arenaviruses (including likely BCNV) primarily use transferrin receptor 1 (TfR1) as their cellular receptor

    • OW arenaviruses like Lassa virus use α-dystroglycan and/or LAMP1

    • This receptor difference influences tissue tropism and pathogenicity

  • Structural Differences:

    • Crystal structures of NW arenavirus GP1-GP2 complexes (JUNV and MACV) reveal distinct architectures compared to OW complexes

    • NW GP1 appears to undergo limited structural alterations upon detachment from GP2 compared to OW GP1

    • GP1-GP2 interactions in NW arenaviruses are more metastable, requiring engineered disulfide bonds for structural studies

  • pH Sensitivity:

    • NW arenaviruses typically trigger fusion at higher pH values (pH ~5.5) compared to OW arenaviruses (pH ~4.5-5.0)

    • This difference affects the subcellular location of fusion and potentially the mechanism of SSP-mediated pH sensing

  • Immunogenic Properties:

    • Neutralizing epitopes differ between NW and OW arenaviruses

    • NW GPC tends to elicit more robust neutralizing antibody responses

    • Cross-reactivity between BCNV and other NW arenaviruses is likely higher than with OW viruses

Phylogenetic analysis places BCNV with WWAV and TAMV in a monophyletic group distinct from South American NW arenaviruses and OW arenaviruses, with nucleotide sequence identities between BCNV and WWAV of approximately 72.7% .

What research approaches can determine the host range and receptor usage of BCNV GPC?

Understanding BCNV's host range and receptor usage requires multiple complementary approaches:

  • Receptor Identification:

    • Receptor interference assays using cells pre-infected with BCNV or related viruses

    • Virus overlay protein blot assays (VOPBA) to identify virus-binding proteins

    • Affinity purification using recombinant GP1 followed by mass spectrometry

    • CRISPR-Cas9 screening to identify host factors required for entry

    • Testing entry into cells expressing different species variants of TfR1 (the common receptor for NW arenaviruses)

  • Host Range Determination:

    • Infection assays in cell lines derived from various species (particularly rodent species)

    • Correlation with distribution of putative receptors

    • Pseudotyped virus entry assays in cells from potential host species

    • Binding studies with recombinant GP1 to cells or purified receptor molecules from different species

  • Ecological Context:

    • Field studies examining BCNV prevalence in different rodent species

    • Analysis of California mice (Peromyscus californicus) receptor sequences, as this is the known natural host

    • Comparative analysis with the host range of closely related WWAV and TAMV

  • Molecular Determinants:

    • Mutagenesis of GP1 residues predicted to be involved in receptor binding

    • Generation of chimeric GPCs with domains from related viruses

    • Structural modeling of GP1-receptor interactions

The natural isolation of BCNV from California mice (Peromyscus californicus) provides strong evidence that this rodent species is a natural reservoir host . Understanding receptor usage and host range has implications for potential zoonotic transmission risk.

VirusNatural HostGeographic DistributionPrimary Receptor
BCNVCalifornia mouse (Peromyscus californicus)Southern CaliforniaPresumed TfR1
WWAVWhite-throated woodrat (Neotoma albigula)Southwestern USTfR1
TAMVHispanic cotton rat (Sigmodon hispidus)Southern FloridaTfR1

How do genetic variations in BCNV GPC correlate with viral fitness and pathogenicity?

Understanding the relationship between BCNV GPC genetic variations and viral fitness/pathogenicity requires several experimental approaches:

  • Comparative Genomics:

    • Sequencing GPC genes from multiple BCNV isolates (five isolates are documented with sequence identities ranging from 96.3% to 100%)

    • Identifying naturally occurring polymorphisms

    • Phylogenetic analysis to correlate GPC sequences with geographic distribution or temporal changes

    • Prediction of selection pressures using dN/dS ratio analysis

  • Reverse Genetics:

    • Generation of recombinant viruses with different naturally occurring GPC variants

    • Introduction of specific mutations at positions of interest

    • In vitro growth curve analysis in relevant cell types

    • In vivo pathogenicity studies in appropriate animal models

  • Structure-Function Correlations:

    • Mapping variations onto structural models of the GPC

    • Focusing on regions involved in receptor binding, membrane fusion, or antibody recognition

    • Biochemical and biophysical characterization of variant GPCs

  • Host Adaptation Studies:

    • Serial passage of BCNV in different cell types to identify adaptive mutations in GPC

    • Characterization of escape mutants selected under immune pressure

    • Competitive fitness assays between viral variants

Studies with Pichinde virus have demonstrated that specific mutations in the SSP (N20A, N37A, and R55A) affect membrane fusion activity and viral virulence differently in vitro versus in vivo, suggesting complex relationships between GPC sequence and pathogenicity . For example, the N20A mutation reduced membrane fusion activity and viral virulence in guinea pigs but did not significantly affect cell entry or viral growth in cell culture, while N37A and R55A mutations did not affect membrane fusion or viral growth in vitro but significantly reduced viral virulence in vivo .

What strategies can be employed to develop neutralizing antibodies against BCNV GPC?

Developing neutralizing antibodies against BCNV GPC requires strategic immunization approaches:

  • Antigen Design:

    • Full-length GPC expressed in mammalian cells (preserves native conformation)

    • Stabilized GP1-GP2 complexes (similar to those used for structural studies)

    • GP1 subunit vaccines (focusing on the receptor-binding domain)

    • DNA vaccines encoding optimized GPC sequences

    • Viral vector vaccines (VSV, adenovirus) expressing BCNV GPC

  • Immunization Protocols:

    • Prime-boost strategies with heterologous delivery platforms

    • Adjuvant selection to promote neutralizing antibody responses

    • Immunization route optimization

    • Dose and schedule determination through systematic testing

  • Screening Methods:

    • Pseudotyped virus neutralization assays (safer than live virus)

    • Competitive binding assays against known receptor interactions

    • Epitope mapping using peptide arrays or hydrogen-deuterium exchange

    • B-cell sorting and single-cell antibody cloning

  • Cross-reactivity Analysis:

    • Testing antibodies against closely related arenaviruses (WWAV, TAMV)

    • Identification of broadly neutralizing epitopes

    • Structure-guided immunogen design to target conserved epitopes

Research with related arenaviruses has shown that engineered GP1-GP2 heterodimers can be antigenically relevant and recognized by neutralizing antibodies, suggesting similar approaches could work for BCNV . The GP1 attachment glycoprotein typically contains the dominant neutralizing epitopes, though some broadly neutralizing antibodies target conserved regions in GP2.

What are the most promising approaches for targeting BCNV GPC with small molecule inhibitors?

Several strategies show promise for developing small molecule inhibitors targeting BCNV GPC:

  • Fusion Inhibitors:

    • Compounds targeting the pH-dependent conformational changes

    • SSP-GP2 interaction inhibitors that prevent fusion triggering

    • GP2 six-helix bundle formation inhibitors

    • High-throughput screens using cell-cell fusion assays or liposome fusion assays

    • Rational design based on structural information about fusion intermediates

  • Receptor Binding Inhibitors:

    • Compounds blocking GP1-receptor interactions

    • Structure-based design using GP1-receptor interface information

    • Peptidomimetic approaches based on receptor binding motifs

    • Fragment-based drug discovery targeting GP1 binding pockets

  • Maturation Inhibitors:

    • SKI-1/S1P protease inhibitors preventing GPC cleavage

    • Compounds disrupting SSP-mediated trafficking

    • Inhibitors of critical post-translational modifications

  • Computational Approaches:

    • Virtual screening against GPC structural models

    • Molecular dynamics simulations to identify druggable pockets

    • Machine learning models trained on known arenavirus inhibitors

  • Screening Methodologies:

    • Pseudotyped virus inhibition assays

    • AlphaScreen or FRET-based protein-protein interaction assays

    • Thermal shift assays to identify GPC-stabilizing compounds

    • Cell-based assays monitoring GPC trafficking or processing

Studies with Pichinde virus have indicated the SSP as a promising target for antiviral development, as it plays essential roles in multiple aspects of GPC function . The conserved nature of certain GPC regions across arenaviruses suggests the possibility of developing broadly active inhibitors.

How can BCNV GPC structure inform the design of broad-spectrum vaccines against arenaviruses?

The structural insights from BCNV and related arenavirus GPCs can guide rational vaccine design strategies:

  • Conserved Epitope Targeting:

    • Structural alignment of multiple arenavirus GPCs to identify conserved surface-exposed regions

    • Focus on functionally constrained domains that cannot easily mutate without fitness cost

    • Engineering of immunogens that present these conserved epitopes while hiding variable regions

    • Computational epitope prediction and design

  • Structure-Based Stabilization:

    • Design of stabilized pre-fusion GPC trimers (similar to approaches used for HIV Env and RSV F)

    • Introduction of disulfide bonds or cavity-filling mutations to lock the preferred conformation

    • Removal of metastable elements that lead to conformational heterogeneity

    • Glycan engineering to direct immune responses to target epitopes

  • Multi-Component Approaches:

    • Mosaic immunogens incorporating sequences from multiple arenaviruses

    • Nanoparticle platforms displaying multiple GPC variants simultaneously

    • Sequential immunization with different arenavirus GPCs to boost cross-reactive responses

    • Inclusion of both T-cell and B-cell epitopes for comprehensive immunity

  • Evaluation Strategies:

    • Antibody breadth assessment against diverse arenavirus pseudotypes

    • T-cell responses to conserved GPC epitopes

    • Challenge studies in appropriate animal models

    • Correlates of protection analysis

What cutting-edge structural biology techniques can advance our understanding of BCNV GPC dynamics?

Several advanced structural biology techniques can provide deeper insights into BCNV GPC dynamics:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Single-particle analysis of detergent-solubilized or nanodisc-embedded GPC

    • Tomography of GPC on virus-like particles or authentic virions

    • Time-resolved cryo-EM capturing fusion intermediates

    • Advantages include capturing multiple conformational states and requiring less protein than crystallography

  • Single-Molecule Techniques:

    • Single-molecule FRET to track conformational dynamics in real-time

    • Optical tweezers to measure forces involved in conformational changes

    • High-speed atomic force microscopy to visualize structural transitions

  • Advanced NMR Techniques:

    • Methyl-TROSY NMR for studying large membrane protein dynamics

    • Solid-state NMR of GPC in native-like membrane environments

    • HDXNMR to map dynamic regions and ligand binding sites

  • Integrative Structural Biology:

    • Combining multiple techniques (cryo-EM, crosslinking-MS, SAXS, NMR)

    • Computational modeling constrained by experimental data

    • AlphaFold2-based predictions combined with experimental validation

  • Advanced Computational Methods:

    • Long-timescale molecular dynamics simulations using specialized hardware

    • Enhanced sampling techniques (metadynamics, replica exchange)

    • Coarse-grained simulations of GPC in complex membrane environments

    • Markov state modeling of conformational transitions

These approaches could reveal critical information about the SSP-GP2 interaction, pH-sensing mechanisms, and conformational changes underlying fusion, potentially identifying new targets for therapeutic intervention. The metastable nature of New World arenavirus GP1-GP2 interactions makes studying these dynamics particularly challenging and important .

How can systems biology approaches integrate GPC structure-function data with host response patterns?

Systems biology approaches can provide a holistic understanding of BCNV GPC interactions with host systems:

  • Multi-omics Integration:

    • Transcriptomics of host cells expressing wildtype versus mutant GPC

    • Proteomics identifying GPC-interacting host proteins

    • Lipidomics examining membrane composition changes induced by GPC

    • Metabolomics tracking cellular metabolic changes during GPC expression

    • Integration of these datasets using computational methods

  • Network Analysis:

    • Construction of protein-protein interaction networks centered on GPC

    • Pathway enrichment analysis of differentially expressed genes/proteins

    • Identification of key regulatory nodes in host response networks

    • Network perturbation analysis using GPC mutants or inhibitors

  • Spatial Systems Biology:

    • Imaging mass spectrometry mapping GPC distribution in infected tissues

    • Spatial transcriptomics of infected tissue sections

    • Correlative light and electron microscopy tracking GPC trafficking

    • Agent-based modeling of virus-host interactions at tissue scale

  • Mathematical Modeling:

    • Kinetic models of GPC-mediated entry steps

    • Ordinary differential equation models of GPC processing and trafficking

    • Stochastic modeling of rare fusion events

    • In silico prediction of intervention points

  • Machine Learning Applications:

    • Pattern recognition in host response data to identify GPC-specific signatures

    • Predictive modeling of virulence based on GPC sequence features

    • Deep learning integration of structural and functional data

These approaches could identify novel host factors required for BCNV entry, reveal unexpected roles of GPC in immune modulation, and provide integrated views of how GPC structure relates to pathogenesis. Studies with Pichinde virus have already shown that certain SSP mutations (N37A and R55A) reduce viral virulence in vivo through mechanisms not apparent in simple in vitro assays, highlighting the need for systems-level approaches .

What are the most effective experimental designs for evaluating BCNV GPC-targeted therapeutics in relevant model systems?

Rigorous evaluation of BCNV GPC-targeted therapeutics requires carefully designed experimental approaches:

  • In Vitro Screening Cascade:

    • Primary biochemical assays (protein-protein interaction, enzyme inhibition)

    • Secondary cellular assays (pseudotyped virus entry, cell-cell fusion)

    • Tertiary mechanistic assays (time-of-addition, bypass assays)

    • Specificity panels against related arenavirus GPCs

    • Counter-screens against host processes to identify off-target effects

    • ADME-Tox preliminary assessment

  • Advanced Cell Models:

    • Relevant primary cell types (macrophages, dendritic cells)

    • 3D organoid cultures (liver, lung, vascular)

    • Co-culture systems incorporating multiple cell types

    • Human tissue explants

    • Microfluidic "organ-on-chip" systems with physiological flows

  • Animal Model Selection:

    • Small animal models (mice with human receptors, if necessary)

    • Guinea pig models (shown to be relevant for Pichinde virus)

    • Selection based on receptor compatibility and disease recapitulation

    • Pharmacokinetic and pharmacodynamic studies to guide dosing

    • Biomarker identification for clinical translation

  • Therapeutic Assessment Parameters:

    • Prophylactic vs. therapeutic efficacy windows

    • Combination studies with standard of care or other antivirals

    • Resistance development monitoring (passage studies)

    • Immune response interactions (immunomodulation)

    • Realistic dosing routes and schedules

  • Translational Considerations:

    • Target product profile definition

    • Biomarker development for clinical studies

    • Animal rule considerations if human efficacy studies not feasible

    • Surrogate endpoints relevant to human disease

For BCNV specifically, studies should consider the natural reservoir host (California mice) and appropriate models that recapitulate relevant aspects of human disease. Since BCNV is closely related to WWAV and TAMV , cross-protection studies against these viruses would be valuable to assess therapeutic breadth.

Model SystemAdvantagesLimitationsRecommended Applications
Pseudotyped virusesSafety, high-throughputLimited to entry processInitial screening, mechanism studies
Cell cultureControlled conditions, genetic manipulationLack tissue complexityTarget identification, resistance studies
Guinea pigsSusceptible to related arenaviruses Not natural host for BCNVIn vivo efficacy, PK/PD studies
California miceNatural host Limited reagents availableReservoir host studies, transmission

How might structural variations in BCNV GPC relate to cross-species transmission potential?

Understanding how BCNV GPC structural variations influence cross-species transmission potential involves several research directions:

  • Receptor Adaptation Analysis:

    • Comparative studies of GPC binding to TfR1 orthologs from different species

    • Identification of specific residues in GP1 that determine species specificity

    • Directed evolution experiments to identify mutations enabling use of human receptors

    • Structural modeling of GP1-receptor interfaces across species barriers

  • Host Range Determinants:

    • Isolation and sequencing of BCNV from different rodent species to identify adaptive mutations

    • Reverse genetics to introduce specific GPC mutations and test host range alterations

    • Assessment of replication efficiency in cells from potential spillover hosts

    • Correlation between GPC sequence features and host range among related arenaviruses

  • Evolutionary Analysis:

    • Selection pressure analysis on GPC sequences from different hosts

    • Identification of host-specific signatures in GPC sequences

    • Ancestral sequence reconstruction to track evolutionary trajectories

    • Molecular clock analyses to date host-switching events

  • Experimental Host-Switching Models:

    • Serial passage in cells from non-native host species

    • Tracking of adaptive mutations in GPC during host switching

    • Competitive fitness assays in different host environments

    • Assessment of transmission efficiency between species

BCNV is naturally found in California mice (Peromyscus californicus), positioning it at an interesting phylogenetic position alongside WWAV and TAMV, separate from South American arenaviruses that have demonstrated human pathogenicity . This offers a unique opportunity to study the molecular determinants that might enable cross-species transmission of North American arenaviruses.

What novel technologies can enhance high-throughput screening for BCNV GPC inhibitors?

Emerging technologies offer new opportunities for discovering BCNV GPC inhibitors:

  • Advanced Screening Platforms:

    • DNA-encoded library (DEL) technology screening billions of compounds

    • Microfluidic droplet-based screening with single-cell resolution

    • Acoustic dispensing ultra-high-throughput screening platforms

    • Cell-painting phenotypic screens to identify compounds affecting GPC trafficking

    • Split-protein complementation assays for GPC-specific protein-protein interactions

  • AI-Driven Drug Discovery:

    • Deep learning models trained on arenavirus inhibitor datasets

    • Generative chemistry approaches to design novel GPC-targeting scaffolds

    • Physics-based free energy calculations for binding prediction

    • Active learning approaches to guide iterative screening campaigns

    • Multi-parameter optimization algorithms for simultaneous property tuning

  • Target-Based Technologies:

    • PROTAC/molecular glue approaches for induced protein degradation

    • RNA-targeting small molecules affecting GPC expression

    • Photopharmacology using light-activatable GPC inhibitors

    • Covalent fragment screening for irreversible inhibitors

    • Bicyclic peptides targeting protein-protein interfaces in GPC

  • Cellular Technologies:

    • CRISPR activation/inhibition screens to identify host factors

    • Biosensor cell lines reporting GPC conformational changes

    • Humanized organoid models for physiologically relevant screening

    • Live-cell imaging platforms tracking viral entry in real-time

    • Electrophysiology platforms monitoring SSP ion channel activity

  • In silico Approaches:

    • Quantum mechanics/molecular mechanics simulations for accurate binding prediction

    • Graph neural networks for structure-based virtual screening

    • Molecular dynamics-based pharmacophore modeling

    • Target-hopping approaches based on binding site similarities

These technologies could accelerate the discovery of inhibitors targeting the essential role of the SSP in mediating viral entry and contributing to viral virulence, as demonstrated in studies with related arenaviruses .

How do emerging tools in structural immunology inform our understanding of BCNV GPC as an immunogen?

Recent advances in structural immunology provide powerful tools for understanding BCNV GPC immunogenicity:

  • Epitope Mapping Technologies:

    • Cryo-EM structures of antibody-GPC complexes

    • X-ray crystallography of antibody-GP1 or antibody-GP2 complexes

    • Hydrogen-deuterium exchange mass spectrometry to map binding footprints

    • Deep mutational scanning to identify critical antibody contact residues

    • Phage display epitope mapping with antibody competition

  • B-cell Repertoire Analysis:

    • Single-cell paired heavy/light chain sequencing from infected or immunized hosts

    • B-cell lineage tracing to track affinity maturation pathways

    • Structural analysis of germline-reverted antibodies to understand maturation pathways

    • Computational immunogen design to engage specific germline precursors

    • B-cell fate mapping in response to different GPC constructs

  • T-cell Response Mapping:

    • MHC-tetramer based CD4+ and CD8+ T-cell epitope identification

    • TCR repertoire sequencing from GPC-specific T cells

    • Structural studies of TCR-peptide-MHC complexes

    • Cytokine profiling of T-cell responses to different GPC domains

  • Integrative Immune Monitoring:

    • Systems serology analyzing Fc-mediated antibody functions

    • Multiplex cytokine profiling during immune response development

    • In vivo imaging of germinal center responses to GPC immunization

    • Single-cell multi-omics of immune cells responding to GPC

  • Computational Immunology:

    • Machine learning prediction of immunodominant epitopes

    • Network models of antibody-epitope landscapes

    • In silico immune response modeling to different GPC constructs

    • Epitope accessibility analysis in different GPC conformational states

Research has shown that engineered GP1-GP2 heterodimers from New World arenaviruses can be antigenically relevant and recognized by neutralizing antibodies . Using similar approaches with BCNV GPC could provide molecular blueprints to guide vaccine development, particularly for generating cross-protective immunity against related North American arenaviruses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.