Recombinant Beet necrotic yellow vein virus Movement protein TGB2

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Movement protein TGB2; 13 kDa protein; P13; Triple gene block 2 protein; TGBp2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Beet necrotic yellow vein virus (isolate Japan/S) (BNYVV)
Target Protein Sequence
MSREITARPNKNVPIVVGVCVVAFFVLLAFMQQKHKTHSGGDYGVPTFSNGGKYRDGTRS ADFNSNNHRAYGCGGSGGSVSSRVGQQLVVLAIVSVLIVSLLQRLRSPPEHICNGACG
Uniprot No.

Target Background

Function
This protein participates in the transport of viral RNA to plasmodesmata. It is likely targeted to plasmodesmata by TGBp3, forming a ribonucleoprotein (RNP) complex with viral RNAs and TGBp1. This protein can regulate plasmodesmata function, increasing their size exclusion limit.
Database Links

KEGG: vg:991085

Protein Families
Virgaviridae/benyvirus TGB2 movement protein family
Subcellular Location
Host cell junction, host plasmodesma. Host endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and organization of BNYVV TGB2?

TGB2 is encoded on RNA 2 of the BNYVV genome as part of the triple gene block (TGB). RNA 2 contains six open reading frames (ORFs) coding for viral encapsidation and cell-to-cell movement functions. The TGB consists of three partially overlapping ORFs encoding three proteins (TGB1, TGB2, and TGB3) that collectively facilitate viral cell-to-cell movement. TGB2 is positioned between TGB1 and TGB3 within this genomic region . The entire viral genome is organized with all RNAs being polyadenylated at the 3' end and capped at the 5' terminal .

What is the molecular weight and structure of the TGB2 protein?

TGB2 (also referred to as P13 or P14 depending on the isolate) is a relatively small protein with a molecular weight of approximately 13-14 kDa. It is characterized by its hydrophobic properties, which are essential for its membrane association and function in viral movement. The protein contains hydrophobic domains that facilitate its interaction with cellular membranes and potentially with plasmodesmata .

How does TGB2 contribute to BNYVV cell-to-cell movement?

TGB2 works in concert with TGB1 and TGB3 to enable BNYVV cell-to-cell movement. Current evidence suggests that the hydrophobic TGB2 and TGB3 proteins provide a docking site for a TGB1-viral RNA complex at the plasmodesmata. At this site, TGB1 (possibly in conjunction with TGB2 and/or TGB3) alters the plasmodesmatal size exclusion limit to facilitate the transit of viral RNA into neighboring cells . Experiments have demonstrated that mutations in any of the TGB proteins disrupt this process and prevent viral cell-to-cell movement, highlighting the essential nature of TGB2 in this mechanism .

What are the most effective systems for expressing recombinant BNYVV TGB2?

For recombinant expression of BNYVV TGB2, researchers have successfully employed several systems:

  • Viral replicon systems: Using modified BNYVV RNA 3 replicons to express TGB2 has proven effective for in planta studies. These replicons can be co-inoculated with other viral components to study TGB2 function in the context of viral infection .

  • Bacterial expression systems: E. coli-based expression systems with appropriate fusion tags (such as MBP, GST, or His-tag) can be used for producing recombinant TGB2 for in vitro studies, though solubility may be a challenge due to TGB2's hydrophobic nature.

  • Transient expression in plants: Agrobacterium-mediated expression in Nicotiana benthamiana allows for rapid production of TGB2 for localization and interaction studies.

  • Yeast expression systems: These can be particularly useful for membrane protein studies and interaction analyses through yeast-two-hybrid or split-ubiquitin systems.

When designing expression constructs, careful consideration of purification tags and their potential interference with TGB2 function is essential, as even single amino acid substitutions can disrupt functionality .

What approaches are most effective for studying TGB2-membrane interactions?

Due to TGB2's membrane association properties, specialized techniques are required:

  • Subcellular fractionation: Differential centrifugation combined with detergent treatments can separate membrane-bound TGB2 from soluble fractions.

  • Fluorescence microscopy: Using TGB2 fused to fluorescent proteins (like GFP) allows visualization of its membrane localization and trafficking in living cells.

  • Membrane flotation assays: These can determine the strength of TGB2-membrane associations and the effects of mutations on these interactions.

  • Electron microscopy with immunogold labeling: Provides high-resolution visualization of TGB2 localization at cellular membranes and plasmodesmata.

  • Lipid binding assays: In vitro assays using liposomes can assess TGB2's lipid preferences and membrane insertion properties.

Each approach provides complementary information, and combining multiple techniques yields the most comprehensive understanding of TGB2-membrane dynamics.

How do researchers effectively study the interaction between TGB2 and other TGB proteins?

Multiple complementary approaches are recommended for robust analysis of TGB protein interactions:

Evidence from trans-complementation experiments indicates that TGB-mediated cell-to-cell movement requires specific "lock-and-key" contacts among cognate TGB proteins, highlighting the importance of protein-protein interaction specificity .

What evidence exists for specific interactions between TGB2 and plasmodesmata components?

Current evidence suggests TGB2 interacts with plasmodesmata components, though specific molecular interactions remain to be fully characterized. Research approaches include:

  • Plasmodesmata protein isolation and co-immunoprecipitation: This identifies physical interactions between TGB2 and plasmodesmatal proteins.

  • Plasmodesmata targeting assays: Using fluorescently tagged TGB2 to track its localization to plasmodesmata and identify sequences responsible for this targeting.

  • Cell-to-cell movement assays: These functional assays measure the impact of TGB2 mutations on plasmodesmatal targeting and viral cell-to-cell movement.

The current model suggests that TGB2 and TGB3 may serve as docking sites at the plasmodesmata for the TGB1-viral RNA complex, facilitating viral movement across cell boundaries . This highlights TGB2's likely interaction with plasmodesmatal components, though the specific molecular partners require further investigation.

How do mutations in TGB2 affect BNYVV cell-to-cell movement?

Mutational analysis has revealed several critical aspects of TGB2 function:

  • Frameshift mutations: Complete inactivation of TGB2 through frameshift mutations abolishes BNYVV cell-to-cell movement, demonstrating its essential role in this process .

  • Domain-specific mutations: Targeted mutations in specific domains of TGB2 have varying effects on viral movement, helping to map functional regions of the protein.

  • Effects on other TGB proteins: Interestingly, frameshift mutations in TGB2 not only eliminate its function but also severely reduce the accumulation of TGB1 (P42), suggesting that TGB2 influences the stability or expression of TGB1 .

  • Trans-complementation studies: Experiments have shown that tobacco mosaic virus (TMV) P30 movement protein can complement movement defects in TGB-defective BNYVV, but tubule-forming movement proteins cannot, highlighting mechanistic differences in viral movement strategies .

These findings collectively indicate that TGB2 plays a multifaceted role in viral movement, not only through its direct function but also by influencing the stability and function of other movement proteins.

Which domains of TGB2 are critical for its function in viral movement?

Critical functional domains of TGB2 include:

  • Hydrophobic domains: These are essential for membrane association and likely for interaction with plasmodesmata.

  • Protein-protein interaction domains: Specific regions mediate interactions with other TGB proteins, particularly TGB1 and TGB3.

  • Conserved motifs: Comparative analysis across different viruses reveals evolutionarily conserved motifs likely crucial for function.

Mutational analysis suggests that even single amino acid substitutions in these crucial domains can abolish protein-protein interactions and compromise viral movement function . This extreme sensitivity to mutation underscores the precise structural requirements for TGB2 function and interactions.

How does the BNYVV TGB2 compare with TGB2 proteins from other viruses with triple gene blocks?

Comparative analysis reveals both similarities and virus-specific differences:

VirusTGB2 Size (kDa)Membrane AssociationFunctional Complementation with BNYVV
BNYVV13-14StrongN/A (native)
PCV14Similar to BNYVVFunctions only when all three PCV TGB proteins are present together
PMTV~13Similar to BNYVVLimited complementation
PVX~12Yes, with different targetingLimited or no complementation

While TGB2 proteins from different viruses share general properties like membrane association and involvement in cell-to-cell movement, trans-complementation experiments demonstrate that they cannot individually substitute for BNYVV TGB2. This suggests virus-specific "lock-and-key" interactions among cognate TGB proteins . These findings highlight that despite structural similarities, the functional specificity of TGB2 is determined by precise interactions with other viral proteins.

What is the relationship between TGB2 and the p25 virulence factor in BNYVV pathogenesis?

While TGB2 and p25 have distinct primary functions—TGB2 in viral movement and p25 in disease symptom development—research suggests potential functional connections:

  • Coordinated roles in infection: TGB2 facilitates viral spread while p25 modulates host responses, particularly related to lateral root development.

  • Host protein interactions: While TGB2 interacts primarily with other viral movement proteins, p25 interacts with host Aux/IAA proteins (BvIAA28, BvIAA2, BvIAA6) that regulate auxin signaling and lateral root development .

  • Combined effects on pathogenesis: The efficient cell-to-cell movement facilitated by TGB2 may enhance the ability of p25 to interact with host factors throughout the root system, amplifying disease symptoms.

Current evidence suggests these proteins serve complementary roles in BNYVV infection, with TGB2 enabling viral spread and p25 modulating host developmental pathways to induce rhizomania symptoms characterized by excessive lateral root formation .

What are the key considerations when designing experiments to study TGB2 trafficking in plant cells?

When investigating TGB2 intracellular trafficking, researchers should consider:

  • Fluorescent protein fusion design:

    • N-terminal vs. C-terminal tags may differentially affect TGB2 function

    • Smaller tags like HA or FLAG may be preferable for functional studies

    • For live imaging, monomeric fluorescent proteins minimize aggregation artifacts

  • Expression systems:

    • Viral replicon-based expression maintains the natural viral context

    • Transient Agrobacterium-mediated expression allows rapid testing but may lead to overexpression artifacts

    • Inducible expression systems help control protein levels

  • Imaging techniques:

    • High-resolution confocal microscopy for subcellular localization

    • FRAP (Fluorescence Recovery After Photobleaching) to study protein mobility

    • Live-cell imaging to track dynamic changes during infection

    • Super-resolution techniques for detailed plasmodesmata localization

  • Controls and validations:

    • Complementation assays to confirm functionality of tagged proteins

    • Membrane markers to confirm subcellular compartment identification

    • Pharmacological treatments to disrupt specific trafficking pathways

When interpreting results, researchers should be aware that fluorescent protein fusions may sometimes alter the natural behavior of TGB2, necessitating validation through multiple complementary approaches .

What techniques are most suitable for studying the role of TGB2 in modifying plasmodesmata permeability?

To investigate TGB2's role in plasmodesmata modification:

  • Microinjection studies: Fluorescent dyes of different molecular weights can be injected into cells to measure changes in plasmodesmatal size exclusion limits in the presence of TGB2.

  • GFP movement assays: Free GFP or GFP fusions of different sizes expressed together with TGB2 can demonstrate the protein's ability to increase plasmodesmatal permeability.

  • Electron microscopy: Transmission electron microscopy with immunogold labeling can visualize structural changes to plasmodesmata induced by TGB2.

  • Plasmodesmata callose staining: Aniline blue staining can reveal TGB2-induced changes in callose deposition at plasmodesmata, which regulates permeability.

  • FRAP analysis: Measuring the rate of fluorescence recovery between adjacent cells can quantify the impact of TGB2 on cell-to-cell molecular transport.

Current models suggest that while TGB1 may directly modify plasmodesmatal permeability, TGB2 likely serves as a docking site at the plasmodesmata for the TGB1-viral RNA complex, indirectly facilitating this process . A comprehensive approach combining multiple techniques provides the most complete picture of TGB2's role in this complex process.

What are the promising approaches for developing BNYVV resistance through targeting TGB2?

Several strategies targeting TGB2 show promise for engineering BNYVV resistance:

  • RNA interference (RNAi): Developing transgenic plants expressing double-stranded RNA targeting TGB2 sequences can trigger specific silencing of this essential viral gene.

  • CRISPR-Cas9 immunity: Expressing CRISPR-Cas systems targeting TGB2 sequences in the viral genome can inhibit viral replication and spread.

  • Dominant negative mutants: Engineering plants to express non-functional TGB2 mutants that interfere with the function of wild-type TGB2 during viral infection.

  • Peptide inhibitors: Designing peptides that mimic TGB2 interaction domains to competitively inhibit essential protein-protein interactions.

  • Host factor modification: Identifying and modifying host proteins that interact with TGB2 to prevent viral co-option of cellular pathways.

Resistance strategies targeting virus movement proteins like TGB2 are particularly attractive as they can potentially provide broad-spectrum resistance against multiple BNYVV strains while limiting the virus's ability to spread systemically through the plant.

What emerging technologies might advance our understanding of TGB2 structure and function?

Cutting-edge approaches that could revolutionize TGB2 research include:

  • Cryo-electron microscopy: This could reveal the three-dimensional structure of TGB2 alone and in complex with other viral and host proteins at near-atomic resolution.

  • Single-molecule tracking: Advanced fluorescence techniques can track individual TGB2 molecules in living cells, revealing dynamics invisible to conventional microscopy.

  • Proximity labeling techniques: BioID or APEX2 fusions with TGB2 can identify transient or weak interacting partners in the native cellular environment.

  • Cellular cryo-tomography: This emerging technique could visualize TGB2-modified plasmodesmata in their native state with unprecedented detail.

  • Protein structure prediction: AI-based prediction tools like AlphaFold2 could provide structural insights into TGB2 and guide rational design of inhibitors.

These technologies promise to bridge current knowledge gaps by providing structural and dynamic information about TGB2 function that has been challenging to obtain with conventional approaches.

What are the common pitfalls when expressing recombinant TGB2 and how can they be overcome?

Researchers frequently encounter several challenges when working with recombinant TGB2:

  • Poor solubility: As a hydrophobic membrane protein, TGB2 often aggregates or shows poor solubility when expressed in heterologous systems.

    • Solution: Use specialized detergents optimized for membrane proteins, consider fusion with solubility-enhancing tags like MBP, or employ membrane-mimicking systems like nanodiscs.

  • Toxicity to expression hosts: Membrane proteins like TGB2 can disrupt host cell membranes when overexpressed.

    • Solution: Use tightly controlled inducible expression systems, lower induction temperatures, or specialized expression strains designed for toxic proteins.

  • Protein instability: TGB2 may be subject to rapid degradation.

    • Solution: Add protease inhibitors during purification, optimize buffer conditions, or co-express with stabilizing interaction partners.

  • Loss of functionality: Recombinant TGB2 may lose activity during purification or when tagged.

    • Solution: Validate functionality through complementation assays, carefully position tags to minimize interference, and use mild solubilization conditions.

  • Difficulty in confirming proper folding: Assessing whether recombinant TGB2 maintains its native structure can be challenging.

    • Solution: Develop functional assays that depend on proper folding, use circular dichroism spectroscopy to assess secondary structure, or validate through interaction studies with known partners.

Experimental evidence indicates that even single amino acid substitutions can disrupt TGB2 interactions and function, underscoring the importance of careful construct design and validation .

How can researchers address data inconsistencies when studying TGB2-mediated viral movement?

When encountering contradictory results in TGB2 research:

  • Inoculation variability: Inconsistent infection can produce conflicting movement data.

    • Solution: Standardize inoculation protocols, include positive and negative controls in each experiment, and increase biological replicates.

  • Plant growth conditions: Environmental variations affect plasmodesmata structure and viral movement.

    • Solution: Strictly control temperature, light, humidity, and plant developmental stage; document all conditions thoroughly.

  • Protein expression inconsistencies: Variable expression levels of TGB2 can lead to different phenotypes.

    • Solution: Use quantitative Western blotting to confirm consistent expression levels across experiments.

  • Viral strain differences: TGB2 function may vary slightly between BNYVV isolates.

    • Solution: Always use the same viral strain or clone when comparing experiments, and clearly report the origin of viral material.

  • Plant species effects: Host factors influencing TGB2 function may differ between experimental plant species.

    • Solution: Be cautious when comparing results from different host plants, and validate key findings in the natural host (sugar beet) when possible.

Research has shown that viral movement systems can interact synergistically when present together during an infection , highlighting the importance of controlling experimental conditions when studying specific components like TGB2.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.