Recombinant Beet necrotic yellow vein virus Movement protein TGB3

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will ship the format currently in stock unless you specify a preference. Please indicate your format requirement at the time of order placement.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional charge. Please contact us in advance to arrange this.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
Movement protein TGB3; 15 kDa protein; P15; Triple gene block 3 protein; TGBp3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Beet necrotic yellow vein virus (isolate Japan/S) (BNYVV)
Target Protein Sequence
MVLVVKVDLSNIVLYIVAGCVVVSMLYSPFFSNDVKASSYAGAVFKGSGCIMDRNSFAQF GSCDIPKHVAESITKVATKEHDADIMVKRGEVTVRVVTLTETLFIILSRLFGLAVFLFMI CLMSIVWFWCHR
Uniprot No.

Target Background

Function

Beet necrotic yellow vein virus Movement protein TGB3 participates in viral RNA transport to plasmodesmata. TGBp3 likely contains plasmodesmata targeting signals and is involved in targeting TGBp2 and the viral RNA-TGBp1 ribonucleoprotein (RNP) complex to plasmodesmata. It can gate plasmodesmata and increase their size exclusion limit.

Database Links

KEGG: vg:991086

Protein Families
Benyvirus TGB3 movement protein family
Subcellular Location
Host cell junction, host plasmodesma. Host endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Beet necrotic yellow vein virus TGB3 protein?

The Beet necrotic yellow vein virus (BNYVV) TGB3 protein is a small membrane protein that belongs to the triple gene block (TGB) protein family. It consists of 132 amino acid residues with a molecular mass in the range of 17-21 kDa, typical of TGB3 proteins from hordeiviruses and pomoviruses. The protein contains two predicted transmembrane helical domains with both N and C termini positioned inside cellular membranes. Important structural features include a conserved cysteine residue motif (H-x3-C-x-C-x2-C) in the N-terminus and a conserved motif (Y-Q-D-L-N) in the intervening loop region between the transmembrane domains . Additionally, the protein contains a putative tyrosine-based sorting motif that is critical for proper subcellular localization and function .

How does TGB3 contribute to viral cell-to-cell movement?

TGB3 plays a critical role in facilitating the cell-to-cell movement of BNYVV by working in concert with other TGB proteins. Research indicates that TGB3 functions primarily in targeting the viral ribonucleoprotein complex to plasmodesmata, the intercellular channels that connect adjacent plant cells. TGB3 associates with the endoplasmic reticulum (ER) membrane and can redirect TGB2 protein from the general ER network to peripheral bodies at the cell periphery . Importantly, TGB3 has been observed to accumulate at plasmodesmata even in the absence of TGB2, suggesting it contains intrinsic plasmodesmatal targeting signals . The protein increases the size exclusion limit of plasmodesmata, facilitating the passage of viral genetic material between cells. These functions collectively enable the virus to spread from infected cells to neighboring healthy cells during the infection process .

What subcellular compartments does TGB3 associate with during infection?

BNYVV TGB3 displays a dynamic association with multiple subcellular compartments during viral infection. When expressed as a fluorescent protein fusion, TGB3 initially associates with the endoplasmic reticulum (ER) network and membranes surrounding the nucleus . The protein localizes to motile granules that utilize the ER-actin network for intracellular movement. Later in the expression cycle, TGB3 becomes incorporated into vesicular structures, but this incorporation requires the presence of TGB2 . These vesicles have been shown to interact with components of the endocytic pathway, as demonstrated by their labeling with FM4-64, a marker for plasma membrane internalization. Additionally, TGB3 forms stationary aggregates at the cell periphery and labels discrete spots at opposing sides of neighboring cell walls, suggesting localization at plasmodesmata . This sequential association with different cellular compartments reflects the protein's multifunctional role in viral trafficking and cell-to-cell movement.

What are the optimal expression systems for studying recombinant BNYVV TGB3?

For studying recombinant BNYVV TGB3, researchers have successfully utilized several expression systems, each with distinct advantages depending on the experimental objectives. For protein production and purification, Escherichia coli-based expression systems have proven effective, as shown by the successful production of His-tagged full-length TGB3 protein (residues 1-132) . For in planta studies investigating subcellular localization and protein interactions, transient expression using Tobacco mosaic virus (TMV)-based vectors has been particularly valuable . These vectors allow for the expression of N-terminal fusions of TGB3 to fluorescent proteins such as GFP or mRFP.

For studying protein function in the context of viral infection, researchers have developed BNYVV RNA3-derived replicons that can express movement proteins in conjunction with TGB-defective BNYVV . This approach enables complementation studies to assess the functionality of mutant proteins. Additionally, biolistic bombardment of plasmids expressing fluorescent protein-tagged TGB3 has been used to visualize protein localization in both healthy and virus-infected cells . When selecting an expression system, researchers should consider factors such as the need for post-translational modifications, the requirement for membrane association, and compatibility with downstream applications like microscopy or biochemical assays.

How can researchers effectively visualize TGB3 trafficking in plant cells?

Effective visualization of TGB3 trafficking in plant cells requires a multi-faceted approach combining advanced imaging techniques with appropriate protein tagging strategies. The most successful method involves creating N-terminal fusions of TGB3 with fluorescent proteins such as GFP or mRFP, which preserves the protein's membrane topology and functionality . These fusion proteins can be expressed in plant epidermal cells either through Agrobacterium-mediated infiltration or biolistic bombardment of expression constructs.

For optimal visualization, confocal laser scanning microscopy with time-lapse imaging capabilities is essential to capture the dynamic movement of TGB3-containing structures along the ER network and transvacuolar strands. To differentiate between various cellular compartments, researchers should employ transgenic plants expressing fluorescent markers for specific organelles or co-express these markers with TGB3 fusions. For instance, ER-targeted GFP can be used to confirm TGB3 association with the endoplasmic reticulum.

The endocytic pathway involvement can be visualized using FM4-64, a lipophilic styryl dye that follows the endocytic pathway from the plasma membrane to the vacuole . Co-localization with specific endosomal markers, such as Ara7 (a Rab5 ortholog marking early endosomes), helps precisely determine the identity of TGB3-containing vesicles. Photobleaching techniques like FRAP (Fluorescence Recovery After Photobleaching) can provide valuable insights into the mobility and exchange rates of TGB3 between different cellular compartments, furthering our understanding of its trafficking dynamics.

What mutagenesis approaches can identify functional domains in TGB3?

Systematic mutagenesis approaches are crucial for identifying and characterizing functional domains within the BNYVV TGB3 protein. Based on research findings, the following strategies have proven effective:

Site-directed mutagenesis targeting conserved motifs is particularly valuable, as demonstrated by studies that identified the importance of the tyrosine-based sorting motif in TGB3 . Mutations in this motif abolished both ER localization and plasmodesmatal targeting, highlighting its critical role in protein trafficking. Researchers should prioritize the conserved cysteine residue motif (H-x3-C-x-C-x2-C) in the N-terminus and the conserved motif (Y-Q-D-L-N) in the intervening loop for initial mutagenesis studies.

Alanine-scanning mutagenesis, where consecutive residues are replaced with alanine, can systematically identify important amino acids throughout the protein sequence. This approach is particularly useful for discovering previously unrecognized functional regions.

Deletion mutagenesis targeting the predicted transmembrane domains can assess their role in membrane association and protein function. Since proper membrane topology is crucial for TGB3 function, creating truncated versions that lack one or both transmembrane domains can provide insights into their specific contributions.

Domain-swapping experiments, where segments of TGB3 are exchanged with corresponding regions from TGB3 proteins of related viruses, can identify virus-specific functional elements. This approach has been valuable in heterologous complementation studies, where researchers found that TGB proteins from different viruses could not individually substitute for their BNYVV counterparts .

For functional validation of mutants, researchers should employ complementation assays using TGB-defective BNYVV and replicons expressing the mutant proteins, followed by assessment of viral movement in plants such as Chenopodium quinoa .

How does TGB3 interact with other triple gene block proteins?

The interaction between TGB3 and other triple gene block proteins is characterized by specific molecular relationships that enable coordinated viral movement. Research indicates that the three TGB proteins of BNYVV function in a highly coordinated manner that requires specific protein-protein interactions . While TGB3 can localize independently to plasmodesmata, its interaction with TGB2 appears to be crucial for certain aspects of viral trafficking .

When co-expressed, TGB3 has been shown to redirect TGB2 from the general endoplasmic reticulum network to peripheral bodies at the cell periphery . This redistribution suggests a direct physical interaction between the two proteins, with TGB3 acting as a targeting factor for TGB2. During viral infection, TGB3 requires TGB2 for incorporation into vesicular structures, providing further evidence for their interdependent relationship .

Heterologous complementation experiments have revealed that the TGB proteins cannot be functionally substituted individually across different viruses. For instance, when the TGB proteins of peanut clump virus were tested for their ability to complement BNYVV movement, they were only functional when all three were supplied together . This finding strongly suggests that the TGB proteins have evolved to interact specifically with their counterparts from the same virus, forming a functional complex that cannot be assembled from mixed viral components.

The exact binding domains and interaction interfaces between TGB3 and other TGB proteins remain to be fully characterized, but the conserved motifs in TGB3, particularly the cytosolic domains, likely play important roles in these protein-protein interactions. Further research using techniques such as co-immunoprecipitation, yeast two-hybrid analysis, and bimolecular fluorescence complementation would help elucidate the precise nature of these interactions.

What host factors interact with TGB3 during viral infection?

Host factor interactions with TGB3 are critical for successful viral infection and movement. Research has revealed several important host protein interactions that facilitate TGB3 function:

The endocytic pathway components appear to be particularly important for TGB3 trafficking. Specifically, TGB2 (which works in concert with TGB3) has been shown to interact with a tobacco protein belonging to the highly conserved RME-8 family of J-domain chaperones . These chaperones are essential for endocytic trafficking in multiple organisms, including Caenorhabditis elegans and Drosophila melanogaster. Given the close functional relationship between TGB2 and TGB3, this interaction likely influences TGB3 trafficking as well.

The cytoskeleton plays a crucial role in TGB3 movement within cells. TGB3-containing granules use the ER-actin network for intracellular movement , suggesting interactions with actin-binding proteins or motor proteins that facilitate transport along actin filaments. While direct binding partners have not been fully characterized, the dependence on the actin cytoskeleton indicates functional interactions with components of this cellular machinery.

Plasmodesmata-associated proteins likely interact with TGB3 at the cell periphery. Given TGB3's ability to increase the size exclusion limit of plasmodesmata and its accumulation at these structures , it presumably interacts with resident plasmodesmatal proteins to modify the channel architecture. Candidates include members of the plasmodesmata-located protein (PDLP) family and other factors involved in plasmodesmatal regulation.

Membrane trafficking components, particularly those involved in ER-to-Golgi transport and the early endosomal system, appear to interact with TGB3. The protein's association with vesicles that contain markers of the endocytic pathway, including the Rab5 ortholog Ara7 , suggests molecular interactions with components of the endosomal sorting machinery.

Identifying additional host factors that interact with TGB3 represents an important area for future research, as these interactions could provide targets for developing resistance strategies against BNYVV infection.

How can protein-protein interaction studies for TGB3 be optimized?

Optimizing protein-protein interaction studies for TGB3 requires specialized approaches that account for its membrane-associated nature and potentially transient interactions. The following methodological considerations are crucial for obtaining reliable results:

Crosslinking approaches can capture transient interactions that might be missed by other methods. Chemical crosslinkers with varying spacer arm lengths, such as DSP (dithiobis(succinimidyl propionate)) or formaldehyde, can stabilize interactions before extraction from membranes. Photoactivatable crosslinkers incorporated into TGB3 can also provide spatial specificity for identifying interaction partners.

Co-immunoprecipitation should be performed using antibodies against epitope tags (such as His-tag) introduced into TGB3 or against the native protein. To preserve membrane-dependent interactions, microsomes can be isolated before solubilization, or in situ approaches like proximity-dependent biotin identification (BioID) can be employed, where a biotin ligase fusion to TGB3 biotinylates nearby proteins.

For in planta studies, bimolecular fluorescence complementation (BiFC) is particularly valuable as it allows visualization of protein interactions in their native cellular context. By fusing complementary fragments of a fluorescent protein to TGB3 and potential interacting partners, researchers can observe reconstituted fluorescence at sites of interaction. This technique has the added advantage of revealing the subcellular locations where these interactions occur.

Advanced proteomics approaches, including quantitative SILAC (Stable Isotope Labeling with Amino acids in Cell culture) combined with mass spectrometry, can identify proteins that differentially associate with wild-type versus mutant TGB3. This approach can reveal interaction partners that depend on specific domains or residues within TGB3.

Validation of interactions should include multiple complementary techniques and functional assays to confirm biological relevance. For instance, identified interactions can be disrupted through targeted mutations and the effects on viral movement assessed in planta.

How does BNYVV TGB3 differ from TGB3 proteins of other plant viruses?

BNYVV TGB3 shares functional similarities with TGB3 proteins from other viruses but exhibits distinct structural and sequence features that reflect evolutionary adaptation. Comparative analysis reveals several key differences:

Size and structural organization: BNYVV belongs to the genus Benyvirus and contains a TGB3 protein similar to those found in hordeiviruses and pomoviruses, with a molecular mass of approximately 17-21 kDa . This contrasts with the smaller TGB3 proteins of potexviruses, which are only about 7-8 kDa. The larger TGB3 proteins, including BNYVV TGB3, typically contain two predicted transmembrane domains with both N and C termini positioned inside cellular compartments, whereas potexvirus TGB3s usually have only a single hydrophobic domain within the C terminus .

Conserved motifs: BNYVV TGB3 contains specific conserved sequence motifs that may not be present in all viral TGB3 proteins. These include a cysteine-rich motif (H-x3-C-x-C-x2-C) in the N-terminus and a conserved Y-Q-D-L-N motif in the intervening loop between transmembrane domains . These motifs likely confer specific functional properties related to membrane association, protein-protein interactions, or subcellular targeting.

Functional complementation capabilities: Heterologous complementation experiments have demonstrated that TGB3 proteins are not generally interchangeable between different viruses. For example, the TGB proteins of peanut clump virus could only complement BNYVV movement when all three were supplied together, not individually . This suggests that BNYVV TGB3 has co-evolved with its corresponding TGB1 and TGB2 proteins to form a specific functional unit.

Plasmodesmata targeting: While many TGB3 proteins localize to plasmodesmata, the specific mechanisms and targeting signals may differ between viruses. BNYVV TGB3 contains a putative tyrosine-based sorting motif that is critical for proper ER localization and plasmodesmatal targeting . Mutations in this motif abolish both ER association and plasmodesmatal localization, highlighting its importance for BNYVV TGB3 function.

These differences reflect the diverse evolutionary paths taken by different viral genera and species, resulting in similar functional outcomes achieved through distinct structural and molecular mechanisms.

What evolutionary insights can be gained from studying TGB3 across different viral species?

Studying TGB3 across different viral species provides valuable evolutionary insights into viral adaptation and host-pathogen co-evolution. Several key evolutionary patterns and principles emerge from comparative analysis:

Functional conservation despite sequence divergence: Despite significant sequence variation among TGB3 proteins from different viral groups, their core function in facilitating viral cell-to-cell movement has been preserved. This represents a case of convergent evolution where different sequence solutions have evolved to fulfill similar functional requirements. The conservation of specific structural elements, such as transmembrane domains and certain motifs, highlights the critical nature of these features for TGB3 function .

Co-evolution with viral components: The observation that TGB proteins from one virus cannot individually substitute for their counterparts in another virus suggests strong co-evolutionary constraints within the triple gene block . The three TGB proteins have evolved as an integrated functional unit, with complementary interfaces that ensure proper complex formation and function. This co-evolution demonstrates the importance of maintaining specific protein-protein interaction networks during viral evolution.

Host adaptation signatures: Variations in TGB3 sequences and structures across different viral species likely reflect adaptation to different host environments. The specific targeting signals and interaction motifs present in BNYVV TGB3 may have evolved to optimize function in its primary host, sugar beet, and related experimental hosts. Comparative analysis of TGB3 proteins from viruses with overlapping or distinct host ranges could reveal specific adaptations to different plant cellular environments.

Modular domain architecture: The organization of TGB3 into distinct functional domains, such as transmembrane regions, targeting motifs, and protein interaction surfaces, suggests a modular evolutionary history. This modularity may have facilitated rapid adaptation through recombination or domain shuffling events during viral evolution. Identifying the boundaries and functions of these modules can provide insights into the evolutionary building blocks of viral movement proteins.

Selective pressures: The patterns of sequence conservation and variation across TGB3 proteins can reveal sites under different selective pressures. Highly conserved residues likely perform essential functions, while variable regions may represent adaptations to specific hosts or evasion of plant defense responses. Molecular evolutionary analyses using methods such as dN/dS ratio calculations can identify signatures of positive or purifying selection across the TGB3 sequence.

Can functional domains of TGB3 be predicted through comparative sequence analysis?

Functional domain prediction for TGB3 through comparative sequence analysis represents a powerful approach that can guide experimental studies. Based on current research, several predictive strategies and identifiable domains emerge:

Transmembrane domain identification can be reliably performed using computational algorithms such as TMHMM, TMpred, or Phobius. For BNYVV TGB3 and related proteins from hordeiviruses and pomoviruses, these analyses typically predict two transmembrane helical domains that establish the protein's membrane topology . The identification of these domains is critical as they determine the orientation of the protein within membranes and define which regions are exposed to the cytoplasm versus the ER lumen.

Conserved motif analysis reveals functionally important regions. Sequence alignments of TGB3 proteins from multiple viral species highlight several conserved motifs, including the cysteine-rich motif (H-x3-C-x-C-x2-C) in the N-terminus and the Y-Q-D-L-N motif in the intervening loop . These highly conserved sequences likely perform essential functions that have been maintained through evolutionary pressure. The conserved cysteine motif may facilitate protein folding, multimerization, or interaction with other proteins through disulfide bond formation.

Targeting signal prediction can identify regions responsible for subcellular localization. Computational tools designed to detect sorting signals, such as those based on machine learning approaches, can identify candidate motifs. For instance, the tyrosine-based sorting motif in BNYVV TGB3 that is critical for ER localization and plasmodesmatal targeting can be predicted by algorithms that recognize YXXφ motifs (where Y is tyrosine, X is any amino acid, and φ is a hydrophobic residue).

Structural homology modeling, combined with sequence analysis, can provide insights into protein folding and potential interaction surfaces. While the three-dimensional structure of BNYVV TGB3 has not been experimentally determined, comparative modeling based on related proteins or fragments with known structures can generate testable hypotheses about structural domains.

Correlated mutation analysis examines patterns of co-evolving residues within the protein sequence. Residues that show coordinated changes across multiple viral species often represent functionally linked positions that maintain structural integrity or form interaction interfaces. Statistical approaches such as mutual information analysis can identify these co-evolving networks within TGB3.

Researchers should note that computational predictions require experimental validation through techniques such as site-directed mutagenesis, deletion analysis, and functional complementation assays to confirm the significance of predicted domains.

What are the latest microscopy techniques for studying TGB3 dynamics in living cells?

The study of TGB3 dynamics in living cells has benefited greatly from recent advances in microscopy techniques that offer unprecedented spatial and temporal resolution. Researchers investigating BNYVV TGB3 can leverage the following cutting-edge approaches:

Super-resolution microscopy techniques have revolutionized the visualization of viral protein localization. Structured Illumination Microscopy (SIM) can achieve resolution down to ~100 nm, allowing for detailed imaging of TGB3 associations with membrane compartments and plasmodesmata. For even higher resolution, Stimulated Emission Depletion (STED) microscopy or Single-Molecule Localization Microscopy (SMLM) techniques like PALM (Photoactivated Localization Microscopy) can resolve structures below 50 nm, enabling visualization of TGB3 nanoclusters and precise localization within plasmodesmata substructures.

Real-time single-particle tracking can monitor individual TGB3-containing particles as they move through the cell. By tagging TGB3 with photoconvertible fluorescent proteins like mEos or Dendra2, researchers can photoactivate a subset of molecules and track their movement with high precision. This approach has been used to visualize the movement of viral components along the ER-actin network and can reveal the kinetics and directionality of TGB3 trafficking.

Correlative Light and Electron Microscopy (CLEM) combines the molecular specificity of fluorescence microscopy with the ultrastructural detail of electron microscopy. For TGB3 studies, this allows researchers to visualize fluorescently tagged proteins using live-cell imaging and then examine the same structures at the ultrastructural level. This technique is particularly valuable for examining TGB3 localization at plasmodesmata, where the intricate channel architecture can be visualized in detail.

Fluorescence fluctuation spectroscopy techniques, including Fluorescence Correlation Spectroscopy (FCS) and Number and Brightness (N&B) analysis, can determine the oligomeric state and concentration of TGB3 in different cellular compartments. These approaches analyze the statistical fluctuations in fluorescence signals to derive information about protein mobility, concentration, and complex formation without perturbing the cellular environment.

Optogenetic approaches offer temporal control over protein activities. By fusing light-sensitive domains to TGB3 or its interacting partners, researchers can use light to trigger or disrupt interactions, allowing for precise temporal manipulation of TGB3 function. This approach enables the dissection of the sequence of events in TGB3-mediated viral movement.

Lattice light-sheet microscopy combines high spatial resolution with reduced phototoxicity, allowing for extended imaging of living cells with minimal perturbation. This technique is ideal for capturing the complete life cycle of TGB3 trafficking from synthesis to plasmodesmatal targeting, providing volumetric data at subsecond temporal resolution.

How can researchers address the challenges of purifying and handling membrane-associated TGB3?

Purification and handling of membrane-associated proteins like TGB3 present significant challenges that require specialized approaches. The following strategies can help researchers overcome these obstacles:

Optimized expression systems are crucial for obtaining sufficient quantities of properly folded TGB3. While E. coli has been successfully used to produce recombinant His-tagged TGB3 , eukaryotic expression systems may provide advantages for maintaining proper folding and post-translational modifications. Insect cell systems (such as Sf9 cells with baculovirus vectors) or yeast expression systems (particularly Pichia pastoris) can provide higher yields of functional membrane proteins with eukaryotic processing machinery.

Membrane extraction requires careful selection of detergents that effectively solubilize the protein while preserving its native structure and function. For TGB3, a screening approach testing multiple detergents is recommended, starting with mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM), digitonin, or LMNG (lauryl maltose neopentyl glycol). The critical micelle concentration (CMC) should be considered when determining detergent concentrations for extraction and subsequent purification steps.

Stabilization strategies can prevent aggregation and denaturation during purification. These include the addition of specific lipids that mimic the native membrane environment, maintaining glycerol in buffers (typically 10-20%), and including cholesterol hemisuccinate or other stabilizing agents. For TGB3, which naturally associates with the ER membrane, the inclusion of ER-derived lipids may enhance stability.

Affinity purification using the His-tag present in recombinant constructs provides a straightforward initial purification step. Immobilized metal affinity chromatography (IMAC) with nickel or cobalt resins can be used under optimized detergent conditions. For higher purity, additional chromatographic steps such as ion exchange or size exclusion chromatography can be employed while maintaining the protein in detergent micelles.

Alternative solubilization approaches include the use of styrene-maleic acid copolymer lipid particles (SMALPs) or nanodiscs, which extract membrane proteins together with their surrounding lipid environment. These methods preserve the native lipid annulus around TGB3 and may better maintain its functional state compared to conventional detergent solubilization.

Functional validation is essential to ensure that purified TGB3 retains its native properties. This can include binding assays with known interaction partners, assessment of oligomeric state through analytical ultracentrifugation or size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS), and reconstitution into liposomes to test membrane association and topology.

For structural studies, crystallization of membrane proteins like TGB3 presents additional challenges. Approaches such as lipidic cubic phase crystallization, which provides a membrane-mimetic environment, may be more successful than traditional vapor diffusion methods. Alternatively, cryo-electron microscopy (cryo-EM) is increasingly used for membrane protein structure determination and may be applicable to TGB3 complexes.

What bioinformatic tools are most valuable for analyzing TGB3 sequence-structure-function relationships?

Bioinformatic analysis of TGB3 sequence-structure-function relationships requires specialized tools designed for membrane proteins and evolutionary analysis. The following computational resources are particularly valuable for TGB3 research:

Membrane topology prediction tools are essential for determining the orientation and membrane-spanning regions of TGB3. Programs such as TMHMM, TMpred, Phobius, and TOPCONS employ different algorithms to predict transmembrane domains and their orientation. For BNYVV TGB3, these tools typically predict two transmembrane domains with both N and C termini on the same side of the membrane . Using a consensus approach that integrates predictions from multiple tools can provide more reliable results.

Conserved motif identification can be performed using tools like MEME (Multiple EM for Motif Elicitation) or GLAM2 (Gapped Local Alignment of Motifs), which discover novel motifs in protein sequences without prior knowledge. For more targeted searches of known motifs, such as the cysteine-rich motif in TGB3's N-terminus, pattern matching tools like ScanProsite or ELM (Eukaryotic Linear Motif) can be employed. These analyses can identify functional elements that may be involved in protein-protein interactions or targeting.

Protein structure prediction has advanced significantly with the development of AlphaFold2, RoseTTAFold, and related deep learning methods. These tools can generate accurate structural models even for membrane proteins like TGB3, particularly when integrated with experimental constraints. The predicted structures can provide insights into the spatial arrangement of functional motifs and potential interaction surfaces. For membrane proteins specifically, tools like MEMOIR (MEmbrane protein MOdeling In Relational framework) incorporate membrane-specific constraints into the modeling process.

Molecular dynamics simulations can model TGB3's behavior within a lipid bilayer environment. Programs such as GROMACS, NAMD, or AMBER, when used with appropriate membrane force fields, can simulate the dynamics of TGB3 in different membrane compositions, providing insights into protein stability, conformational changes, and lipid interactions that may be relevant to function.

Coevolutionary analysis tools like EVcouplings, GREMLIN, or DCA (Direct Coupling Analysis) can identify co-evolving residue pairs within TGB3 or between TGB3 and interacting proteins. These co-evolving residues often represent physically interacting positions that are functionally important. The resulting contact maps can guide experimental studies of protein-protein interactions and structural organization.

Comparative genomics approaches, including tools like BLAST, Clustal Omega for multiple sequence alignment, and phylogenetic analysis software such as MEGA, RAxML, or IQ-TREE, enable the comparison of TGB3 sequences across different viral species. These analyses can identify conserved regions under purifying selection (suggesting functional importance) and rapidly evolving regions that may be involved in host adaptation or immune evasion.

Integrative platforms that combine multiple analysis methods, such as InterPro, which integrates data from resources like Pfam, PROSITE, and SMART, provide comprehensive annotation of protein domains and functional sites. For TGB3, these resources can generate integrated predictions that draw on multiple lines of evidence to identify functional elements.

What are the most promising strategies for developing TGB3-targeted antiviral interventions?

Developing TGB3-targeted antiviral interventions represents a promising approach for controlling BNYVV infections. Several strategic directions show particular potential:

Structure-based inhibitor design targeting TGB3's functional domains offers a precise approach. With advances in protein structure prediction and modeling, researchers can now design small molecule inhibitors that specifically bind to critical regions of TGB3, such as the conserved motifs or targeting signals . High-throughput virtual screening of compound libraries against predicted TGB3 structures can identify candidate molecules that interfere with its membrane association or protein-protein interactions. These compounds can then be optimized through medicinal chemistry approaches to improve potency and specificity.

Peptide-based inhibitors derived from TGB3 interaction interfaces provide another promising strategy. By identifying the specific sequences involved in TGB3's interactions with other viral proteins or host factors, researchers can design competitive peptides that mimic these interfaces but lack functional activity. These peptide mimetics can potentially disrupt the formation of functional viral movement complexes, thereby inhibiting viral spread without affecting normal cellular processes.

RNA interference (RNAi) approaches targeting TGB3 mRNA can effectively reduce viral protein expression. The design of small interfering RNAs (siRNAs) or artificial microRNAs (amiRNAs) that specifically target conserved regions of the TGB3 coding sequence can trigger degradation of the viral RNA. Transgenic plants expressing these RNA molecules have shown resistance to various viral infections, and similar approaches could be developed against BNYVV by targeting its TGB3 gene.

CRISPR-Cas technologies offer innovative antiviral strategies. Rather than targeting the plant genome, CRISPR-Cas13 systems can be programmed to specifically recognize and cleave viral RNA sequences encoding TGB3, effectively inhibiting viral replication and spread. This approach has the advantage of being highly specific and adaptable to different viral strains through simple modification of the guide RNA sequences.

Host factor engineering represents an indirect but potentially effective approach. By identifying and modifying host proteins that interact with TGB3 during viral infection , researchers can develop plants with altered versions of these factors that no longer support TGB3 function. This strategy targets the host-pathogen interface rather than the virus directly, potentially providing durable resistance that is difficult for the virus to overcome through mutation.

Combination approaches that simultaneously target multiple viral components, including TGB3 and other movement proteins, may provide more robust protection against viral infection and reduce the likelihood of resistance development. Such multilayered interventions could involve combinations of the strategies outlined above or integration with other antiviral approaches.

How might studying TGB3 contribute to broader understanding of plant membrane protein trafficking?

Research on TGB3 provides unique insights into fundamental aspects of plant membrane protein trafficking that extend beyond viral pathology. Several contributions to broader understanding include:

Novel membrane trafficking pathways have been revealed through TGB3 research. The protein's association with both the endoplasmic reticulum and components of the endocytic pathway highlights previously underappreciated connections between these cellular systems. The observation that TGB3-containing vesicles are labeled with FM4-64 and co-localize with markers of early endosomes (such as Ara7) suggests that recycling endosomes may play important roles in protein trafficking to plasmodesmata. These findings challenge conventional models of membrane protein transport and expand our understanding of the interconnectedness of endomembrane compartments in plant cells.

Plasmodesmata targeting mechanisms are illuminated by TGB3 studies. The identification of specific sorting signals, such as the tyrosine-based motif in TGB3 that is critical for plasmodesmatal localization , provides valuable information about the molecular requirements for directing proteins to these intercellular channels. This knowledge contributes to the broader understanding of how endogenous plant proteins are targeted to plasmodesmata, a process that remains incompletely understood despite its importance in plant development and physiology.

ER-cytoskeleton interactions are highlighted by the observation that TGB3-containing granules use the ER-actin network for intracellular movement . This finding reinforces the importance of the cytoskeleton in organizing and facilitating protein transport along the ER network. The mechanisms by which TGB3 engages with this transport system may reveal principles applicable to the trafficking of endogenous plant membrane proteins that utilize similar pathways.

Membrane microdomain organization may be influenced by viral proteins like TGB3. The localization of TGB3 to specific ER subdomains and its ability to redirect other proteins to these sites suggests that it may induce or stabilize membrane microdomains with distinct lipid and protein compositions. Studying these effects can provide insights into how membrane compartmentalization is established and regulated in plant cells, a topic of considerable interest in cell biology.

Host protein recruitment mechanisms exemplified by TGB3's interactions with cellular factors demonstrate how proteins can repurpose host machinery for novel functions. The interaction of the TGB proteins with components of the endocytic pathway, including an RME-8 family J-domain chaperone , illustrates how cellular proteins can be coopted for alternative purposes. Understanding these recruitment mechanisms may reveal flexible nodes in cellular pathways that could be targeted for various biotechnological applications.

Membrane protein topology determination is another area where TGB3 research contributes valuable insights. The methods used to establish TGB3's membrane orientation, with specific domains exposed to different cellular compartments, exemplify approaches that can be applied to other plant membrane proteins with complex topologies.

What technical innovations are needed to advance our understanding of TGB3 function?

Advancing our understanding of TGB3 function requires several technical innovations that would overcome current limitations in studying this membrane-associated viral protein:

High-resolution structural determination of membrane-embedded TGB3 represents a critical technological need. While computational predictions provide valuable insights, experimental structures of TGB3 in its native membrane environment would reveal precise molecular details of its function. Innovations in cryo-electron microscopy (cryo-EM), particularly the development of improved detergents or membrane mimetics compatible with single-particle analysis, could enable structure determination of TGB3 alone or in complex with other viral and host proteins. Additionally, advances in solid-state NMR methodologies optimized for small membrane proteins could provide complementary structural information, particularly regarding dynamic regions.

Single-molecule imaging technologies capable of tracking individual TGB3 molecules in living plant cells would revolutionize our understanding of its trafficking dynamics. Current techniques often rely on overexpression of fluorescent fusion proteins, which may not accurately reflect the behavior of TGB3 at physiological concentrations. The development of more sensitive cameras, brighter and more photostable fluorophores, and improved labeling strategies that maintain protein function would enable visualization of TGB3 movement at endogenous expression levels. Advanced light-sheet microscopy configurations optimized for plant tissues could provide the necessary sensitivity with reduced phototoxicity.

Plant cell-free expression systems specifically designed for membrane proteins would facilitate biochemical and biophysical studies of TGB3. While E. coli-based expression has been successful , plant-derived cell-free systems would provide a more native folding environment with appropriate chaperones and membrane compositions. Technical innovations in preparing stable plant cell extracts with preserved membrane fractions and optimized translation efficiency could enable rapid production of functional TGB3 for various analyses.

Inducible protein depletion or inactivation systems adapted for plant viral proteins would allow temporal control over TGB3 function. Technologies such as auxin-inducible degrons or light-controlled protein inactivation, when applied to TGB3, would enable precise dissection of its roles at different stages of viral infection. The development of viral vectors carrying these controllable elements, compatible with BNYVV infection systems, would represent a significant technical advance.

Improved plasmodesmata isolation and analysis methods would enhance studies of TGB3's interactions at these critical intercellular junctions. Current plasmodesmata enrichment protocols yield limited material and often do not preserve protein-protein interactions. Technical innovations in tissue fractionation, membrane purification, and crosslinking strategies could generate higher-purity plasmodesmata preparations suitable for proteomic analysis of TGB3-containing complexes.

Genome-wide screening technologies optimized for plant-virus interactions would accelerate the identification of host factors involved in TGB3 function. Adaptation of CRISPR-Cas9-based screens for use in plant systems, combined with high-throughput phenotypic assays for viral movement, could reveal previously unknown host components that interact with TGB3. Similarly, innovations in proximity labeling techniques compatible with membrane-associated proteins in plant cells would enable more comprehensive identification of the TGB3 interactome.

Advanced computational methods integrating multiple data types (structural predictions, evolutionary analysis, interaction networks, and experimental constraints) into unified models of TGB3 function would provide a systems-level understanding of this protein's role in viral movement. The development of machine learning approaches specifically trained on plant virus-host interactions could generate novel hypotheses about TGB3 function that might not be apparent from individual data sources.

How can TGB3 be used as a tool for studying plasmodesmata structure and function?

TGB3 presents unique opportunities as a molecular tool for investigating plasmodesmata, the complex intercellular channels that remain challenging to study due to their small size and embedment within the cell wall. Several research applications leverage TGB3's properties:

As a plasmodesmata-targeting marker, fluorescently tagged TGB3 provides a powerful tool for visualizing these structures in living cells. The protein's ability to accumulate at plasmodesmata in the absence of other viral proteins makes it particularly valuable for this purpose. Researchers can use TGB3 fusions to identify and track plasmodesmata in different cell types and developmental contexts, enabling investigation of plasmodesmata formation, modification, and turnover during plant development and in response to environmental stimuli.

For studying size exclusion limit (SEL) modification, TGB3 offers a controlled system to investigate the molecular mechanisms underlying plasmodesmatal permeability regulation. Since TGB3 increases the SEL of plasmodesmata , researchers can use it as a tool to trigger channel dilation and then investigate the structural changes and host responses that accompany this process. By comparing the effects of wild-type and mutant TGB3 proteins, specific domains responsible for SEL modification can be identified, providing insights into how endogenous plant proteins might regulate similar processes.

In protein trafficking studies, TGB3 can serve as a model cargo for investigating the cellular machinery involved in targeting proteins to plasmodesmata. The identification of the tyrosine-based sorting motif in TGB3 that is essential for plasmodesmatal localization provides a defined targeting signal that can be used to probe the requirements for this trafficking pathway. By fusing this motif to reporter proteins or creating chimeric proteins with various TGB3 domains, researchers can dissect the cellular components involved in recognizing and processing plasmodesmata-destined proteins.

For proteomic analysis of plasmodesmata, TGB3 can function as a molecular hook to capture and identify associated proteins. Techniques such as proximity labeling, where TGB3 is fused to a biotin ligase that biotinylates nearby proteins, can reveal the protein composition of plasmodesmata and identify host factors that interact with these structures. This approach can be combined with comparative analysis between different cell types or developmental stages to understand how plasmodesmata composition changes in different contexts.

As a tool for manipulating intercellular communication, TGB3 expression can be used to selectively modify plasmodesmatal permeability in specific cell types or tissues. By placing TGB3 under the control of tissue-specific or inducible promoters, researchers can create experimental systems where cell-to-cell communication is transiently altered, allowing investigation of the role of symplastic connectivity in developmental processes, signaling events, or responses to pathogens.

In correlative microscopy studies, TGB3's specific localization to plasmodesmata makes it an excellent marker for identifying these structures in electron microscopy after initial light microscopy imaging. This application is particularly valuable for investigating the ultrastructural changes that occur in plasmodesmata during viral infection or in response to other cellular stresses.

Can TGB3-based systems be developed for biotechnology applications?

TGB3's unique properties as a membrane-associated protein with specific targeting capabilities offer several promising biotechnology applications:

Targeted protein delivery systems based on TGB3 could enable the selective transport of fused cargo proteins to plasmodesmata or specific membrane compartments. By creating fusion proteins combining TGB3 targeting domains with biologically active proteins, researchers could direct therapeutic or agriculturally beneficial proteins to precise subcellular locations. This approach could be particularly valuable for delivering enzymes that modify cell wall components near plasmodesmata, potentially influencing plant development or stress responses.

Controlled intercellular transport enhancement using inducible TGB3 expression systems could facilitate the movement of beneficial molecules between plant cells. Since TGB3 increases the size exclusion limit of plasmodesmata , regulated expression could create temporary channels for the intercellular transport of RNA, proteins, or small molecules that would normally be restricted to individual cells. This capability could enhance the distribution of defense signals, developmental regulators, or even experimental agents throughout plant tissues.

Membrane protein expression and trafficking studies could benefit from TGB3-derived expression tags. The protein's efficient association with the endoplasmic reticulum and incorporation into the secretory pathway make it a potential candidate for developing expression tags that enhance membrane integration or vesicular trafficking of recombinant proteins. Chimeric constructs incorporating TGB3 targeting domains could improve the yield and proper localization of difficult-to-express membrane proteins in plant expression systems.

Biosensor development using TGB3's membrane topology could create novel tools for monitoring membrane dynamics or intercellular communication. By incorporating sensing domains (such as fluorescent reporters that respond to specific stimuli) into the cytoplasmic or ER-luminal regions of TGB3, researchers could develop sensors that localize to specific membrane compartments or plasmodesmata. These biosensors could detect changes in pH, calcium levels, or other signaling molecules in these specialized cellular regions.

Plant-based production of nanovesicles for drug delivery represents another potential application. The ability of TGB3 to be incorporated into vesicular structures when co-expressed with TGB2 suggests that these viral proteins could be used to generate specialized membrane vesicles in plant biofactory systems. These vesicles could potentially be engineered to carry therapeutic compounds or biological molecules and may offer advantages in terms of biocompatibility and production scale compared to synthetic alternatives.

Cell-specific genetic modification tools could leverage TGB3's plasmodesmatal localization to develop more precise genome editing technologies for plants. By fusing genome editing components (such as CRISPR-Cas systems) to modified versions of TGB3, it might be possible to enhance the cell-to-cell movement of these editing tools, allowing more efficient transformation of plant tissues without the need for extensive tissue culture and regeneration procedures.

What experimental controls are essential when performing TGB3 localization studies?

When conducting TGB3 localization studies, several experimental controls are essential to ensure reliable and interpretable results:

Expression level controls are critical since overexpression of membrane proteins can lead to artifactual localization patterns. Researchers should include constructs expressing TGB3 at different levels, ideally comparing native expression levels (using viral infection) with transient expression systems. Quantitative assessment of expression using western blotting or fluorescence intensity measurements should accompany localization data. Additionally, inducible expression systems that allow titration of protein levels can help determine whether observed localization patterns are concentration-dependent.

Fluorescent tag position controls are necessary because the position of the tag (N-terminal versus C-terminal) can significantly affect membrane protein topology and function. For TGB3, N-terminal fusions have been successfully used in localization studies , but researchers should verify that the fusion protein retains biological activity, such as the ability to complement viral movement in TGB3-deficient viruses. Ideally, both N-terminal and C-terminal fusions should be tested, along with internal tagging at permissive sites if the termini are critical for function.

Tag-only controls expressing the fluorescent protein alone (without TGB3) are essential to distinguish between specific localization patterns and general distribution patterns of the tag. This control helps identify potential artifacts caused by the fluorescent protein itself, such as aggregation or nonspecific membrane association. For membrane studies, including an additional control with the fluorescent protein fused to a different membrane protein with well-characterized localization patterns provides a valuable reference point.

Marker co-localization controls using established markers for specific subcellular compartments are crucial for accurate interpretation of TGB3 localization. These should include markers for the endoplasmic reticulum (such as ER-targeted GFP), Golgi apparatus, endosomes (such as the Rab5 ortholog Ara7), plasma membrane, and plasmodesmata . Time-course experiments with these markers can reveal the dynamic progression of TGB3 through different compartments during expression and trafficking.

Pharmacological treatment controls using inhibitors of specific cellular processes can validate the mechanisms underlying TGB3 localization. These should include cytoskeleton inhibitors (such as latrunculin B for actin or oryzalin for microtubules), membrane trafficking inhibitors (such as brefeldin A), and endocytosis inhibitors (such as tyrphostin A23). Comparing TGB3 localization patterns before and after these treatments can reveal dependencies on specific cellular machinery.

Cell type controls examining TGB3 localization in different cell types (epidermal cells, mesophyll cells, vascular cells) are important since plasmodesmata composition and membrane trafficking pathways can vary between tissues. Similarly, different plant species should be tested when possible, as there may be host-specific differences in protein localization and trafficking.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.