Recombinant Beijerinckia indica subsp. indica ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Details

ParameterDetails
Gene NameatpB
Uniprot IDB2IGL1
Protein LengthPartial (exact sequence length varies by production method)
FunctionIntegral to the F₀ sector, facilitates proton translocation across membranes
Amino Acid SequencePartial sequence available (full sequence not disclosed in public datasets)

The atpB gene encodes a hydrophobic transmembrane protein critical for forming channels in the ATP synthase complex. Its partial recombinant form is often used in biochemical studies to avoid solubility challenges associated with full-length proteins .

Production and Expression Systems

Recombinant atpB is synthesized in multiple host systems to optimize yield and functional integrity:

Host SystemTag/ModificationPurityProduct Code
Mammalian CellsUnspecified>85% (SDS-PAGE)CSB-MP015070BSP1
E. coliHis-tag or Avi-tagNot specifiedCSB-EP015070BSP1
YeastUnspecifiedNot specifiedCSB-YP015070BSP1
BaculovirusUnspecifiedNot specifiedCSB-BP015070BSP1

Key Features:

  • E. coli: Enables His-tagged or biotinylated (Avi-tag) variants for affinity purification .

  • Mammalian Cells: Higher post-translational modification fidelity for structural studies .

  • Yeast/Baculovirus: Used for large-scale production or specialized folding requirements .

Comparative Analysis of Expression Systems

MetricMammalian CellsE. coliYeast
YieldModerateHighModerate
Post-Translational ModificationsNative-likeMinimalBasic
CostHighLowModerate
Use CaseStructural biologyHigh-throughput screeningScalable production

Research Gaps and Future Directions

  • Full-Length Recombinant Production: Current partial constructs limit studies on subunit interactions.

  • Functional Characterization: Limited data on ATP synthase activity of recombinant atpB in isolation.

  • Industrial Optimization: Scaling up mammalian cell production for biotechnological applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For optimal long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
atpB; Bind_0743; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712)
Target Names
atpB
Target Protein Sequence
MAEPHEIDPIHQFHIDRIIPLHFLGTDVSFTNAAFFMLVIVALASLVLLAGTRNHSLVPG RLQSIAEVSYEFIASTLQLSSGRDGMRFFPFVFSIFMFVFLANLIGLVPYTFTVTSQIAV TFGLAMIVIGTVVIYGLIKHGTHFLGIFAPSGVSPLLLPFMIMIEVISFISRPISLSIRL FANMLAGHITLKVMGGFVAGLLGAGSVYALVAPLPLAMVVIFTAFELLVAFLQAYVFTIL TCVYLNDAVHPGH
Uniprot No.

Target Background

Function
As a key component of the proton channel, this protein plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase and what is the function of its subunits in Beijerinckia indica?

ATP synthase is a multi-subunit enzyme complex that functions as a rotary nanomotor to synthesize ATP. In bacteria like Beijerinckia indica, ATP synthase consists of two primary domains: F1, located in the cytoplasm, and F0, embedded in the membrane. The F1 domain contains the catalytic sites for ATP synthesis, while the F0 domain forms the proton channel through the membrane .

The F0 domain includes the membrane-embedded subunits that facilitate proton translocation. Particularly important is subunit a, which forms part of the proton pathway and interacts with the c-ring to couple proton movement to rotation . Another notable component is subunit b/b' (encoded by atpG in Beijerinckia indica), which forms part of the peripheral stalk connecting F1 and F0 domains .

What are the optimal storage conditions for recombinant Beijerinckia indica ATP synthase proteins?

For recombinant ATP synthase subunits from Beijerinckia indica, optimal storage conditions include:

  • Temperature: Store at -20°C for regular use; -80°C for extended storage

  • Buffer: Tris-based buffer with 50% glycerol, optimized for protein stability

  • Handling: Avoid repeated freezing and thawing cycles

  • Working aliquots: Can be maintained at 4°C for up to one week

These conditions help maintain protein structure and function while preventing degradation or aggregation that could compromise experimental results.

What is the role of ATP synthase oligomerization and how does it impact function?

ATP synthase exists not only as individual complexes but also forms dimers and higher-order oligomers, which has significant functional implications:

  • Mitochondrial ATP synthase oligomers play a role in determining cristae morphology

  • The assembly of ATP synthase oligomers involves specific interactions between F0 components

  • Oligomerization may enhance the efficiency of ATP synthesis by creating localized proton microenvironments

  • The arrangement of ATP synthase complexes in the membrane can influence proton movement and energy coupling

In bacteria like Beijerinckia indica, the oligomerization state may influence the enzyme's efficiency in different environmental conditions, though specific research on this aspect in Beijerinckia is limited in the provided sources.

What are effective methods for expressing and purifying recombinant ATP synthase subunits?

Successful expression and purification of ATP synthase subunits requires careful attention to several factors:

StepMethodologyConsiderations
Expression systemE. coli with codon-optimized geneMatch codon usage to expression host
Vector selectionVectors with purification tags (His, GST, etc.)Consider tag position to minimize functional interference
Growth conditionsOptimal temperature and induction parametersMembrane proteins often benefit from lower induction temperatures
Cell lysisMechanical or detergent-based methodsGentle methods to preserve protein structure
SolubilizationMild detergents (e.g., octylglucoside)Critical for membrane-associated subunits
PurificationIMAC followed by size exclusion chromatographyMultiple steps improve purity
StorageGlycerol-containing buffer at -20°C or -80°CPrevent freeze-thaw cycles

For membrane-embedded subunits like subunit a, detergent selection is particularly critical to maintain the native structure while effectively solubilizing the protein from the membrane.

How can functional assays be designed to study ATP synthase activity?

Several complementary approaches can be used to assess ATP synthase function:

  • ATPase activity assays

    • Native activity (without detergents): Measures the coupled enzyme function

    • Stimulated activity (with octylglucoside): Assesses maximal catalytic potential

    • These assays can distinguish between assembly defects and catalytic defects

  • ATP synthesis measurements

    • In vitro assays using purified enzyme or membrane vesicles

    • Measurements can be conducted under varying conditions (pH, temperature, ion concentrations)

    • Critical for understanding the synthetic capacity of the enzyme

  • Growth phenotype analysis

    • Non-fermentative growth on substrates like malate requires functional ATP synthase

    • Growth assays under different conditions can reveal conditional defects

  • Proton translocation measurements

    • Fluorescent pH indicators can be used to monitor proton movement

    • Essential for understanding the coupling between proton transport and ATP synthesis

What critical residues determine proton specificity and translocation in ATP synthase?

Several key residues in ATP synthase subunits play crucial roles in proton translocation:

  • In subunit a:

    • A conserved arginine (equivalent to Arg-210 in E. coli) in transmembrane helix 4 (TMH4) is essential for preventing proton short-circuiting and facilitating the protonation/deprotonation of c-subunit carboxylates

    • In alkaliphilic bacteria, a lysine residue (Lys-180 in Bacillus pseudofirmus OF4) is important for proton capture and retention at high pH

  • In the c-subunit:

    • A conserved carboxylate residue in each c-subunit acts as the proton binding site

    • The protonation/deprotonation of this residue drives rotation of the c-ring

  • Interactions between subunits:

    • The interface between subunit a and the c-ring forms the pathway for protons

    • Specific residues at this interface determine proton selectivity and the efficiency of coupling

How do mutations in key residues affect ATP synthase function?

Mutations in key residues can have diverse effects on ATP synthase function, providing insights into the mechanism:

How can comparative studies of ATP synthases inform evolutionary adaptations?

Comparative analysis of ATP synthases from different organisms provides insights into evolutionary adaptations:

  • Environmental adaptations:

    • Alkaliphilic bacteria have specific adaptations in ATP synthase for function at high pH

    • These include unique residues like Lys-180 in the a-subunit of Bacillus pseudofirmus OF4

    • Different bacterial species show adaptations to their specific environmental niches

  • Structural comparisons:

    • The number of c-subunits in the rotor ring varies between species (10-15 depending on the organism)

    • These variations affect the bioenergetic efficiency of ATP synthesis

  • Genetic organization:

    • The organization of ATP synthase genes differs between species

    • In some bacteria, subunits a and A6L are encoded by mitochondrial DNA, while in others all subunits are encoded in the nuclear genome

What approaches are most effective for studying assembly mechanisms of ATP synthase?

Several complementary approaches can be used to study ATP synthase assembly:

  • Native gel electrophoresis:

    • Blue Native PAGE (BN-PAGE) and Clear Native PAGE (CN-PAGE) can separate intact complexes and assembly intermediates

    • CN-PAGE uses milder detergents and can preserve more labile interactions

  • Genetic approaches:

    • Deletion of specific genes to identify assembly factors

    • Site-directed mutagenesis to study the role of specific residues in assembly

  • Pulse-chase experiments:

    • Track the incorporation of newly synthesized subunits into the complex

    • Useful for determining the sequence of assembly steps

  • Structural biology:

    • Cryo-electron microscopy to visualize assembly intermediates

    • Cross-linking studies to identify subunit interactions during assembly

Current models suggest that ATP synthase assembly involves multiple pathways that converge at later stages, with modules like the c-ring, F1, and peripheral stalk assembling separately before joining to form the complete complex .

How can researchers address inconsistent results in ATP synthase functional assays?

When encountering inconsistent results in ATP synthase studies, consider these methodological approaches:

  • Verify protein integrity:

    • Check protein expression levels using immunoblotting

    • Assess protein stability under assay conditions

    • Confirm proper subunit stoichiometry in purified complexes

  • Standardize assay conditions:

    • Control pH precisely, especially when comparing different mutants

    • Standardize membrane potential or proton gradient in synthesis assays

    • Use consistent detergent concentrations in ATPase assays

  • Use multiple complementary assays:

    • Compare results from ATPase and ATP synthesis measurements

    • Correlate in vitro assays with growth phenotypes

    • Assess proton translocation directly when possible

  • Control for indirect effects:

    • Verify that mutations don't affect protein expression or stability

    • Consider effects on membrane integrity

    • Rule out pleiotropic effects on other cellular processes

What are the common challenges in studying bacterial ATP synthases and their solutions?

Research on bacterial ATP synthases faces several challenges:

ChallengeSolution Approaches
Membrane protein purificationOptimize detergent selection; consider nanodiscs or amphipols for stabilization
Maintaining coupled activityUse gentle purification methods; reconstitute into liposomes to restore the native membrane environment
Mutagenesis of essential genesUse conditional expression systems; introduce mutations on plasmids before chromosomal integration
Measuring proton translocationEmploy pH-sensitive fluorophores; develop reconstituted systems with controlled proton gradients
Structural analysisCombine cryo-EM with biochemical approaches; use cross-linking to capture transient states
Species-specific adaptationsPerform comparative studies; express enzymes in heterologous systems for direct comparison

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.