Recombinant Beijerinckia indica subsp. indica Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Bind_3208; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712)
Target Names
mscL
Target Protein Sequence
MFKEFREFALKGNVVDLAIGVIIGAAFGRIIDSLVNDIIMPFFGALGGLDFSNYFFPLTK GVTASSLAEARRQGAVLAWGNFLTVAVNFLIIAFVLFLIVRSINTFRKRVLKENLEVTPP AKPQDVVVLEEIRDLIAARRA
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Beijerinckia indica subsp. indica and why is its mscL protein significant?

Beijerinckia indica subsp. indica is an aerobic, acidophilic, exopolysaccharide-producing, N₂-fixing soil bacterium belonging to the Rhizobiales order of Alphaproteobacteria. It is the type strain of the genus Beijerinckia and is commonly found as a free-living bacterium in acidic soils and in plant rhizosphere and phyllosphere environments . The large-conductance mechanosensitive channel (mscL) from this organism represents one of the first identified exclusively mechanosensitive ion channels, serving as a model system for studying mechanotransduction mechanisms. The significance of this particular mscL variant lies in its robust expression capabilities and potential applications in neuronal mechano-sensitization research .

How does the bacterial mscL channel function at the molecular level?

The mscL channel functions as a molecular transducer that converts mechanical force into electrical signals. When subjected to membrane tension, the channel undergoes a conformational change from a closed to an open state, creating a large-conductance pore that allows ions and small molecules to pass through. This mechanism serves primarily as a protective "emergency release valve" in bacteria during osmotic shock, but can be exploited in research contexts for controlled mechanosensitive responses . The channel's gating is directly regulated by membrane tension without requiring secondary messengers or metabolic energy, making it a pure mechanosensor.

What expression systems are most efficient for recombinant B. indica mscL production?

The most efficient expression system documented for B. indica mscL is E. coli, with the protein typically expressed as an N-terminal His-tagged construct for ease of purification. The recombinant expression vector should contain a strong promoter (such as a modified CMV promoter) and appropriate antibiotic resistance markers . When designing expression constructs, researchers should consider:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, rapid growth, cost-effectiveMay require optimization of codon usage
Mammalian cellsPost-translational modifications, membrane integrationLower yield, higher cost, longer production time
Cell-free systemsRapid production, avoids toxicity issuesHigher cost, lower yield for membrane proteins

For neuronal applications, lentiviral vectors have proven effective for stable integration and expression in primary neuronal cultures .

What purification protocol yields the highest quality functional mscL protein?

For optimal purification of functional His-tagged B. indica mscL, researchers should implement the following methodological approach:

  • Lyse bacterial cells in a buffer containing mild detergents that preserve protein structure

  • Perform initial purification using Ni-NTA affinity chromatography

  • Further purify via size exclusion chromatography to remove aggregates

  • Confirm purity via SDS-PAGE (>90% purity is achievable with optimized protocols)

  • Verify functional integrity through reconstitution into liposomes and patch-clamp analysis

The purified protein is typically obtained as a lyophilized powder that requires careful reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL prior to experimental use .

What storage conditions maximize stability of purified recombinant mscL?

For optimal stability, reconstituted mscL should be supplemented with 5-50% glycerol (final concentration) and stored as aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles. Working aliquots can be maintained at 4°C for up to one week, but prolonged storage at this temperature is not recommended . Prior to opening, vials should be briefly centrifuged to bring contents to the bottom. Researchers should avoid repeated freeze-thaw cycles as these can significantly reduce protein functionality.

How can researchers effectively use mscL to mechanically stimulate neuronal networks?

To effectively implement mscL-based mechanical stimulation of neuronal networks, researchers should follow this methodological framework:

  • Design appropriate expression vectors for neuronal expression of mscL (lentiviral vectors are commonly used)

  • Transfect/transduce primary neuronal cultures or neuronal cell lines with the mscL expression construct

  • Validate expression through immunofluorescence or functional assays

  • Apply calibrated mechanical stimuli through:

    • Patch-clamp with defined suction pressures

    • Microfluidic pressure systems

    • Focused ultrasound stimulation

    • Magnetic nanoparticle-mediated force application

When establishing mechano-sensitized neuronal networks, researchers should verify network development by assessing cell survival rates, synaptic puncta formation, and spontaneous network activity patterns to ensure that mscL expression does not adversely affect normal neuronal function .

What advantages does mscL offer compared to other neuronal stimulation techniques?

The bacterial mscL channel offers several distinct advantages as a neuronal stimulation tool:

Stimulation MethodAdvantages of mscLLimitations to Consider
Electrical stimulationCell-type specificity, non-invasiveRequires genetic modification
OptogeneticsComplementary approach, can be co-expressedMay have different temporal resolution
ChemogeneticsMore precise spatial controlMay have slower onset than chemical activators
UltrasoundCompatible with ultrasound neuromodulationRequires optimization of parameters

The pure mechanosensitivity of engineered mscL, combined with its wide genetic modification library, makes it a versatile tool for developing targeted mechano-genetic approaches to neuronal stimulation. This property allows researchers to convey information non-invasively into intact brain tissue with potential cell-type specificity .

How can patch-clamp electrophysiology be optimized for mscL functional analysis?

For optimal electrophysiological analysis of mscL function, researchers should implement the following specialized protocol:

  • Prepare cells expressing mscL or purified protein reconstituted in artificial lipid bilayers

  • Use borosilicate glass pipettes with resistances of 3-5 MΩ for whole-cell recordings

  • Apply calibrated negative pressure steps (typically in the range of -5 to -300 mmHg)

  • Record at both positive and negative holding potentials to characterize conductance

  • Analyze channel kinetics including:

    • Pressure threshold for activation

    • Open probability as a function of pressure

    • Single-channel conductance

    • Opening and closing rates

This methodological approach allows precise quantification of mechanosensitive channel properties and enables comparison between wild-type and engineered variants.

What methodologies exist for engineering mscL variants with altered properties?

Advanced researchers can modify mscL properties through several genetic engineering approaches:

Engineering TargetMethodologyExpected Outcome
Pressure sensitivityMutation of hydrophobic pore residuesLower activation threshold
Ion selectivityModification of pore-lining residuesAltered ion preference
Ligand gatingIntroduction of ligand-binding domainsChemical AND mechanical gating
Light sensitivityFusion with photosensitive domainsOptical control of mechanosensitivity

Site-directed mutagenesis targeting specific transmembrane domains can produce variants with altered gating properties. Additionally, fusion constructs combining mscL with other sensing domains can create multi-modal channels that respond to both mechanical and chemical/optical stimuli .

How does B. indica mscL compare to other bacterial mechanosensitive channels?

While the search results don't provide direct comparisons between B. indica mscL and other bacterial mechanosensitive channels, the general properties of bacterial mscL proteins include:

  • High conductance (2-3 nS in standard conditions)

  • Low ion selectivity

  • Activation by membrane tension rather than membrane potential

  • Homopentameric structure

The B. indica genome has similarities to related bacteria, with 57% of its genes having homologues in Methylocella silvestris, though the specific properties of its mscL compared to other bacterial channels remain to be fully characterized .

What is the genomic context of mscL in B. indica and how does this inform research applications?

The B. indica subsp. indica genome consists of 4,170,153 bp with two additional plasmids of 181,736 and 66,727 bp. The genome contains 3,982 open reading frames (ORFs) predicted using Glimmer, with 3,784 predicted protein-coding genes. The mscL gene (annotated as Bind_3208) exists within this genomic context . Understanding the genomic environment may provide insights into regulatory elements that control native mscL expression, which could be valuable for designing optimized expression systems or for studying evolutionary relationships between mechanosensitive channels.

What are common challenges in mscL expression and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant mscL:

ChallengeMethodological Solution
Low expression yieldOptimize codon usage for expression system; try different fusion tags
Protein aggregationAdjust detergent type and concentration; optimize purification buffer
Loss of functionalityEnsure proper membrane incorporation; validate with patch-clamp
Bacterial toxicityUse tightly regulated inducible expression systems
Mammalian cell toxicityTitrate expression levels; use inducible promoters

When expressing mscL in mammalian neurons, researchers should carefully monitor cell health parameters, as improper expression levels or trafficking could potentially disrupt normal cellular function .

How can researchers validate that recombinant mscL is properly folded and functional?

To verify proper folding and functionality of recombinant mscL, researchers should employ multiple complementary approaches:

  • Biophysical characterization:

    • Circular dichroism spectroscopy to assess secondary structure

    • Size exclusion chromatography to confirm pentameric assembly

    • Thermal stability assays to assess protein stability

  • Functional validation:

    • Reconstitution into liposomes and patch-clamp analysis

    • Fluorescent dye release assays in response to osmotic shock

    • Cell swelling/lysis protection assays in bacterial systems

  • In neuronal systems:

    • Patch-clamp recordings upon application of calibrated suction pressures

    • Calcium imaging during mechanical stimulation

    • Measurement of downstream signaling pathway activation

What potential exists for developing mscL as a therapeutic target or tool?

While the search results don't directly address therapeutic applications, the ability to express functional mscL in mammalian cells suggests several potential therapeutic directions:

  • Targeted mechano-stimulation of specific neuronal populations for treating neurological disorders

  • Development of mechanically-gated gene expression systems for localized therapeutic protein production

  • Creation of cellular biosensors that respond to mechanical cues in disease environments

  • Novel neuromodulation approaches that combine mechanical stimulation with existing therapeutic modalities

These applications would require further research into tissue-specific expression systems, optimization of in vivo delivery methods, and extensive safety validation.

How might combining mscL with other sensing modalities enhance neuroscience research?

Advanced research could explore multimodal sensing approaches by combining mscL with:

  • Optogenetic tools for simultaneous optical and mechanical control

  • Voltage indicators for real-time visualization of mechanically-induced activity

  • Calcium sensors to monitor downstream signaling effects

  • Transcriptional reporters to study mechano-sensitive gene expression

Such combinatorial approaches would enable researchers to dissect the complex interplay between mechanical forces and neuronal function with unprecedented precision and temporal resolution .

What key considerations should guide experimental design when working with recombinant mscL?

When designing experiments with recombinant B. indica mscL, researchers should carefully consider:

  • Expression level optimization to prevent potential cellular toxicity

  • Appropriate controls including non-expressing cells and non-functional mscL mutants

  • Validation of channel functionality through multiple complementary assays

  • Careful characterization of mechanical stimulation parameters

  • Assessment of potential off-target effects on cellular physiology

Researchers should also consider the specific advantages and limitations of B. indica mscL compared to other mechanosensitive channels or alternative stimulation approaches for their particular experimental question .

What methodological advances are needed to fully exploit mscL in neuroscience research?

To fully realize the potential of mscL in neuroscience, several methodological advances are needed:

  • Development of cell-type specific expression systems for targeted in vivo applications

  • Creation of standardized mechanical stimulation protocols with precise spatial and temporal resolution

  • Engineering of mscL variants with altered sensitivity, kinetics, or ion selectivity for specific applications

  • Integration with existing neural recording technologies for closed-loop systems

  • Establishment of in vivo delivery methods for localized expression in intact animal models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.