Recombinant Beijerinckia indica subsp. indica Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Beijerinckia indica subsp. indica Lipoprotein signal peptidase (LspA) is an enzyme that belongs to the peptidase A8 family . LspA specifically catalyzes the removal of signal peptides from prolipoproteins . Beijerinckia indica subsp. indica is an aerobic, acidophilic, exopolysaccharide-producing, N2-fixing soil bacterium . Beijerinckia indica is used in agriculture to improve soil fertility through nitrogen fixation, which benefits a variety of crops by increasing the availability of nitrogen .

Properties

PropertyDescription
Chemical NameRecombinant Beijerinckia indica subsp. indica Lipoprotein signal peptidase (lspA)
SynonymsRecombinant Beijerinckia indica subsp. indica Lipoprotein signal peptidase (lspA)
CBNumberCB015628981
Molecular FormulaNot available
Molecular Weight0
MDL NumberNot available
MOL FileMol file

Function and Mechanism

LspA is a lipoprotein signal peptidase, which cleaves between the G and the C* in the lipobox, where C* represents a diacylglyceryl (DAG)-modified cysteine . The enzyme plays a crucial role in bacterial cell envelope integrity and function . LspA's mechanism involves blocking the catalytic dyad in this aspartyl protease .

Structure

LspA contains a catalytic dyad and a β-cradle, a hemi-cylindrically shaped sheet that sits on the membrane . The β-cradle is proposed to accommodate the stretch of residues to the C-side of the LspA cleavage site in lipoprotein substrates .

Inhibitors

Globomycin inhibits LspA by lodging the β-hydroxyl of its g.Ser between the catalytic aspartates . Myxovirescin also inhibits LspA, but approaches from the other side of the substrate-binding pocket compared to globomycin .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; Bind_1007; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712)
Target Names
lspA
Target Protein Sequence
MSPRVLGGLAAFLCLVLDQANKLWLIHVFDIEARRPVRLAPFFDIIYERNPGISYSLFRA QSAMGRWILVALTLFAILLLSIWLWRATNRLVALALGCIIGGALGNAIDRIAAGAVADFY YFHIGSFSWYVFNLADAAIVAGVALLILDAFTSEEAGVPAPDSEGHS
Uniprot No.

Target Background

Function
This protein is a specific catalyst for the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Beijerinckia indica subsp. indica and what are its key characteristics?

Beijerinckia indica subsp. indica is an aerobic, acidophilic soil bacterium that fixes nitrogen and produces copious exopolysaccharide material. It is phylogenetically closely related to members of the genera Methylocella and Methylocapsa, but unlike these specialized bacteria that primarily grow on one-carbon compounds, Beijerinckia indica is a broad-spectrum chemoorganotroph that does not oxidize methane or methanol. The organism has been noted for its versatile metabolic capabilities and potential applications in bioremediation .

Unlike methanotrophic bacteria, Beijerinckia indica has evolved a more generalist chemoorganotrophic lifestyle. Some strains of Beijerinckia have demonstrated capabilities in degrading aromatic compounds, making them potentially valuable for petroleum purification or bioremediation processes .

What is Lipoprotein signal peptidase (lspA) and what is its biological function?

Lipoprotein signal peptidase (lspA), also known as Signal peptidase II or SPase II, is an enzyme that plays a crucial role in the processing of bacterial lipoproteins. The enzyme functions by cleaving the signal peptide from prolipoproteins, which is an essential step in lipoprotein maturation and trafficking within bacterial cells .

In structural terms, lipoprotein signal peptidases typically contain transmembrane domains that anchor them to the bacterial cell membrane, allowing them to process lipoproteins as they emerge from the secretion pathway. The protein's function is critical for bacterial cell envelope biogenesis and proper localization of lipoproteins to their functional sites .

How is Recombinant Beijerinckia indica subsp. indica Lipoprotein signal peptidase (lspA) typically produced?

Recombinant Beijerinckia indica subsp. indica Lipoprotein signal peptidase (lspA) is typically produced through heterologous expression systems, most commonly in Escherichia coli. Based on similar recombinant protein production methods, the process generally involves:

  • Cloning the lspA gene into an expression vector with an appropriate promoter

  • Transformation of the construct into a suitable E. coli strain

  • Induction of protein expression under optimized conditions

  • Cell lysis and protein purification

For efficient purification, the protein is often fused with affinity tags such as polyhistidine (His-tag), which allows for purification using affinity chromatography techniques. The expressed protein is typically available in lyophilized powder form and requires proper reconstitution before use in experimental procedures .

What are the optimal conditions for expression of recombinant Lipoprotein signal peptidase (lspA)?

While specific optimized conditions for Beijerinckia indica subsp. indica Lipoprotein signal peptidase (lspA) expression are not directly mentioned in the search results, drawing parallels from similar recombinant protein expression systems suggests the following parameters:

  • Expression System: E. coli is the preferred expression system due to its rapid growth and high protein yields .

  • Induction Parameters:

    • Temperature: Typically 16-30°C, with lower temperatures often favoring proper protein folding

    • Inducer concentration: For IPTG-inducible systems, concentrations of 0.1-1.0 mM are common

    • Duration: 4-24 hours post-induction, depending on protein stability and toxicity

  • Growth Media: Enriched media (LB or TB) supplemented with appropriate antibiotics for selection

  • Cell Density at Induction: Mid-log phase (OD600 of 0.6-0.8) is typically optimal for maximum yield

For membrane-associated proteins like Lipoprotein signal peptidase, expression conditions may require optimization to prevent toxicity to the host and ensure proper membrane integration.

What purification strategies are most effective for Recombinant Beijerinckia indica subsp. indica Lipoprotein signal peptidase (lspA)?

Effective purification of Recombinant Beijerinckia indica subsp. indica Lipoprotein signal peptidase (lspA) typically employs the following strategies:

  • Affinity Chromatography: For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins is the primary method of purification .

  • Buffer Optimization: Based on similar proteins, appropriate buffers might include:

    • Lysis buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, plus detergents for membrane protein solubilization

    • Wash buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20-40 mM imidazole

    • Elution buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 250-500 mM imidazole

  • Additional Purification Steps:

    • Size exclusion chromatography for higher purity

    • Ion exchange chromatography to remove contaminants with different charge properties

The final purified protein should achieve greater than 90% purity as determined by SDS-PAGE analysis .

What are the recommended storage conditions for maintaining Lipoprotein signal peptidase (lspA) stability?

Based on similar recombinant proteins, optimal storage conditions for Recombinant Beijerinckia indica subsp. indica Lipoprotein signal peptidase (lspA) are:

  • Long-term Storage:

    • Store at -20°C/-80°C upon receipt

    • Lyophilized powder is the most stable form for long-term storage

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working Stock Preparation:

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for stability

    • Store working aliquots at 4°C for up to one week

  • Reconstitution Protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Dissolve in a Tris/PBS-based buffer, pH 8.0, containing 6% Trehalose

Repeated freezing and thawing should be avoided as it can lead to protein denaturation and loss of activity .

What is known about the structural characteristics of Lipoprotein signal peptidase (lspA)?

While specific structural information for Beijerinckia indica subsp. indica Lipoprotein signal peptidase (lspA) is limited in the provided search results, insights can be drawn from related proteins:

Lipoprotein signal peptidases are typically integral membrane proteins with multiple transmembrane domains. Based on structural studies of homologous proteins, they likely adopt a conformation that positions the active site at the membrane interface to facilitate access to the signal peptide of prolipoproteins during processing.

Structural modeling approaches, similar to those used for Leishmania META1 (which shares similarities with bacterial secretion-related proteins), could be employed to predict the structure of lspA. Such homology modeling might reveal important structural features related to substrate binding and catalytic activity .

How does Lipoprotein signal peptidase (lspA) compare functionally with homologous proteins from other bacterial species?

Lipoprotein signal peptidase (lspA) functions are generally conserved across bacterial species, but with species-specific adaptations. Drawing parallels from the search results about META1 proteins and their bacterial homologs:

  • Functional Conservation: Despite relatively low direct sequence identity between homologs (as little as 25% in some cases), the core function of signal peptide cleavage is typically preserved .

  • Evolutionary Selection: Like META1, which is under strong purifying selection as indicated by Ka/Ks values <1, lspA proteins are likely subject to evolutionary constraints that maintain their functional integrity while allowing species-specific adaptations .

  • Domain Structure: The META domain, which appears in proteins related to secretion and membrane association, may have functional similarities across different bacterial species, suggesting conserved mechanisms despite sequence divergence .

  • Potential Structural Homology: Functional similarities may be underpinned by structural conservation rather than sequence identity, as seen in the case of META1, HslJ, and MxiM, which share structural homology despite low sequence identity .

What are the catalytic mechanisms of Lipoprotein signal peptidase (lspA)?

The catalytic mechanism of Lipoprotein signal peptidase (lspA) involves the recognition and cleavage of the signal peptide from prolipoprotein substrates. While specific details for Beijerinckia indica lspA are not provided in the search results, a general catalytic mechanism can be inferred from homologous enzymes:

  • Substrate Recognition: The enzyme recognizes specific motifs in the signal sequence of prolipoproteins, typically a lipobox motif with a conserved cysteine residue.

  • Cleavage Reaction: The peptidase cleaves the signal peptide just before the lipid-modified cysteine residue, releasing the signal peptide and generating the mature lipoprotein.

  • Active Site Residues: The catalytic activity typically depends on conserved residues that form the active site, often including serine, lysine, and/or aspartic acid residues.

  • Membrane Association: The catalytic activity occurs in the context of the membrane environment, with the active site positioned to access the substrate as it emerges from the secretion pathway.

How can structural homology modeling be applied to understand Lipoprotein signal peptidase (lspA) function?

Structural homology modeling can provide valuable insights into Lipoprotein signal peptidase (lspA) function through the following approaches:

  • Template Selection: Identifying appropriate structural templates, such as solved structures of homologous proteins. For example, the approach used for Leishmania META1, which employed 3D-JURY structure prediction to identify structural homologs, could be applied to lspA .

  • Model Generation: Using software like MODELLER to generate structural models based on the selected templates. This would involve aligning the sequence of Beijerinckia indica lspA with templates and computing a three-dimensional model .

  • Structural Analysis: Examining the model for functionally important features such as:

    • Putative active site residues

    • Substrate binding pockets

    • Transmembrane regions

    • Conserved structural motifs

  • Comparative Analysis: Superimposing the model with structures of functionally related proteins, as was done with META1, HslJ, and MxiM, which revealed striking structural similarities despite low sequence identity .

  • Functional Prediction: Identifying potential functional sites, such as the hydrophobic cavity found in META1 through structural superposition with MxiM, which was implicated in secretory processes .

What experimental approaches are optimal for studying the enzymatic activity of Recombinant Beijerinckia indica subsp. indica Lipoprotein signal peptidase (lspA)?

Optimal experimental approaches for studying the enzymatic activity of Recombinant Beijerinckia indica subsp. indica Lipoprotein signal peptidase (lspA) include:

  • In vitro Cleavage Assays:

    • Using synthetic peptide substrates containing the signal sequence and cleavage site

    • Fluorogenic or chromogenic substrates that produce measurable signals upon cleavage

    • Mass spectrometry to analyze cleavage products

  • Membrane Reconstitution Systems:

    • Reconstitution of purified lspA into liposomes or nanodiscs to study activity in a membrane environment

    • Detergent-solubilized systems for initial characterization

  • Mutagenesis Studies:

    • Site-directed mutagenesis of putative catalytic residues to confirm their role

    • Creation of truncation mutants to define functional domains

    • Mutagenesis of hydrophobic residues in potential substrate-binding cavities, similar to the approach used to study META1's involvement in secretory processes

  • Inhibitor Studies:

    • Testing known inhibitors of signal peptidases

    • Structure-activity relationship studies with modified inhibitors

    • Development of specific inhibitors based on structural information

  • Expression Analysis:

    • QRT-PCR to determine transcript levels under different conditions

    • Western blotting to assess protein expression patterns

    • Correlation of expression with phenotypic changes, as demonstrated with META1 in Leishmania

What are the implications of lspA function for bacterial pathogenesis and potential antimicrobial development?

Lipoprotein signal peptidase (lspA) has significant implications for bacterial pathogenesis and represents a potential target for antimicrobial development:

  • Role in Pathogenesis:

    • Proper processing of lipoproteins is essential for bacterial cell envelope integrity

    • Many lipoproteins processed by lspA are virulence factors or contribute to bacterial survival in the host

    • Upregulation of related proteins (like HslJ) has been observed in more pathogenic bacterial strains

  • Conservation and Essentiality:

    • The conservation of lspA across bacterial species suggests its essential role

    • The absence of a direct human homolog makes it an attractive antimicrobial target

  • Structural Insights for Drug Design:

    • Identification of putative hydrophobic cavities, similar to those found in META1 and MxiM, could provide targets for small molecule inhibitors

    • Structural homology with proteins involved in secretion systems (like MxiM) suggests potential roles in virulence factor secretion

  • Evolutionary Considerations:

    • Evidence of strong purifying selection pressure (as seen with META1) indicates the functional importance of these proteins

    • Potential horizontal gene transfer events suggest evolutionary significance in bacterial adaptation

  • Secretion System Connection:

    • The structural homology between META1, HslJ, and MxiM (a secretin pilot protein essential for type III secretion system function) suggests potential involvement of lspA in secretory processes critical for virulence

    • Inhibition of these processes could attenuate bacterial virulence without directly killing bacteria, potentially reducing selective pressure for resistance

What evidence exists for horizontal gene transfer of Lipoprotein signal peptidase (lspA) genes across bacterial species?

While direct evidence for horizontal gene transfer (HGT) of Beijerinckia indica lspA is not provided in the search results, insights can be drawn from related proteins:

  • Phylogenetic Anomalies: Evidence of HGT can often be detected through phylogenetic analyses that reveal unexpected relationships between genes from distantly related organisms. Similar analyses to those conducted for META1, which identified bacterial HslJ as its closest relative outside the Trypanosomatidae family, could potentially reveal HGT events involving lspA .

  • GC Content Analysis: Anomalies in GC content can indicate genes of foreign origin. For example, META1 in Leishmania shows significantly lower GC content (6.3 standard deviations below genome average), suggesting its foreign origin . Similar analyses could be performed for lspA genes.

  • Codon Adaptation Index (CAI): Low CAI values, as observed for META1 and other laterally transferred genes like PTR-1 and Coproporphyrinogen in Leishmania, can indicate genes of exogenous origin . CAI analysis of lspA could provide evidence of potential HGT.

  • Selective Pressure: Genes acquired through HGT often show evidence of strong purifying selection, as observed with META1 (Ka/Ks values < 1), reflecting constraints on their evolution . Similar selection pressure analysis on lspA could provide insights into its evolutionary history.

How do structural and functional comparisons of lspA across different bacterial species inform our understanding of protein evolution?

Structural and functional comparisons of lspA across different bacterial species provide valuable insights into protein evolution:

What are the key differences between Lipoprotein signal peptidase (lspA) from Beijerinckia indica and related proteins from pathogenic bacteria?

While specific differences between Beijerinckia indica lspA and pathogenic bacterial homologs are not directly addressed in the search results, potential key differences can be inferred:

  • Expression Regulation: In pathogenic bacteria, lspA and related proteins may show different expression patterns in response to host-associated environmental cues. For instance, HslJ transcript is upregulated in more pathogenic strains of E. coli and the protein is heat inducible , suggesting adaptation to host environments.

  • Substrate Specificity: lspA from pathogenic bacteria may have evolved to process specific virulence-associated lipoproteins, whereas Beijerinckia indica lspA might be optimized for processing lipoproteins involved in environmental adaptation and nitrogen fixation .

  • Structural Adaptations: Pathogen-associated lspA proteins might contain structural adaptations that enhance their stability or activity under host conditions (e.g., human body temperature, pH changes, immune defense mechanisms).

  • Association with Virulence Mechanisms: In pathogens, lspA may be more closely integrated with virulence mechanisms such as secretion systems. The structural similarity between META1 and MxiM (a secretin pilot protein essential for type III secretion) suggests potential functional parallels .

  • Environmental vs. Host Adaptation: As Beijerinckia indica is an environmental soil bacterium , its lspA likely evolved for functions related to soil survival, plant association, and nitrogen fixation, whereas pathogen homologs would be adapted to host interaction and immune evasion.

What are the technical challenges in expressing and purifying membrane-associated proteins like Lipoprotein signal peptidase (lspA)?

Expressing and purifying membrane-associated proteins like Lipoprotein signal peptidase (lspA) presents several technical challenges:

  • Expression System Selection:

    • E. coli is commonly used but may not provide the correct membrane environment

    • Alternative systems like yeast, insect cells, or cell-free systems may be required for proper folding

  • Toxicity to Host Cells:

    • Overexpression of membrane proteins can disrupt host cell membrane integrity

    • Inducible expression systems with tight regulation are often necessary

    • Lower expression temperatures (16-20°C) may reduce toxicity

  • Solubilization Strategies:

    • Selection of appropriate detergents is critical (common options include DDM, LDAO, or CHAPS)

    • Detergent screening is often necessary to identify optimal solubilization conditions

    • Nanodiscs or amphipols may provide better membrane-mimetic environments

  • Purification Complications:

    • Detergent micelles can interfere with binding to chromatography resins

    • Protein aggregation during concentration steps

    • Potential loss of activity during purification

  • Stability Assessment:

    • Thermal shift assays may need modification for membrane proteins

    • Limited shelf-life in detergent solutions

    • Need for lipid reconstitution to maintain native-like environment

What analytical methods are most suitable for characterizing the structural properties of Recombinant Beijerinckia indica subsp. indica Lipoprotein signal peptidase (lspA)?

Multiple analytical methods are suitable for characterizing the structural properties of Recombinant Beijerinckia indica subsp. indica Lipoprotein signal peptidase (lspA):

  • Computational Methods:

    • Homology modeling based on related structures, as demonstrated with META1

    • Molecular dynamics simulations to study protein-membrane interactions

    • Sequence-based structure prediction tools specific for membrane proteins

  • Spectroscopic Techniques:

    • Circular Dichroism (CD) spectroscopy to assess secondary structure content

    • Fluorescence spectroscopy to monitor conformational changes

    • Fourier-Transform Infrared Spectroscopy (FTIR) for secondary structure in membrane environment

  • High-Resolution Structural Methods:

    • X-ray crystallography (challenging for membrane proteins)

    • Nuclear Magnetic Resonance (NMR) spectroscopy (used for HslJ structure determination )

    • Cryo-electron microscopy for larger complexes

  • Biophysical Characterization:

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation to assess oligomeric state

    • Thermal shift assays to evaluate stability

  • Functional Probes:

    • Site-directed spin labeling combined with electron paramagnetic resonance (EPR)

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Chemical cross-linking followed by mass spectrometry

What experimental design considerations are important when investigating the role of Lipoprotein signal peptidase (lspA) in bacterial physiology?

Important experimental design considerations when investigating the role of Lipoprotein signal peptidase (lspA) in bacterial physiology include:

  • Genetic Manipulation Strategies:

    • Conditional knockout systems if lspA is essential

    • CRISPR-Cas9 or recombineering for precise genome editing

    • Complementation studies to confirm phenotype specificity

    • Dominant negative mutants as an alternative approach

  • Expression Analysis:

    • QRT-PCR to quantify transcript levels under various conditions

    • Western blotting with specific antibodies to monitor protein expression

    • Promoter-reporter fusions to study regulation

    • Comparison between virulent and attenuated strains, as done with META1

  • Environmental Variables:

    • Testing expression and activity under relevant stress conditions (pH, temperature, nutrient limitation)

    • For Beijerinckia indica, nitrogen fixation conditions would be particularly relevant

    • Temporal analysis during different growth phases

  • Substrate Identification:

    • Proteomics approaches to identify processed lipoproteins

    • Comparison of lipoprotein profiles in wild-type vs. lspA-deficient strains

    • In vitro processing assays with candidate substrates

  • Phenotypic Characterization:

    • Membrane integrity assays

    • Stress resistance tests

    • Biofilm formation

    • For Beijerinckia indica, nitrogen fixation efficiency and exopolysaccharide production

  • Controls and Validation:

    • Use of known inhibitors of signal peptidases as positive controls

    • Complementation with homologs from other species to assess functional conservation

    • Inclusion of catalytically inactive mutants as negative controls

By carefully considering these methodological aspects, researchers can design robust experiments to elucidate the role of Lipoprotein signal peptidase (lspA) in bacterial physiology while avoiding technical pitfalls and ensuring reliable results.

What are the potential applications of Recombinant Beijerinckia indica subsp. indica Lipoprotein signal peptidase (lspA) in biotechnology?

Recombinant Beijerinckia indica subsp. indica Lipoprotein signal peptidase (lspA) has several potential biotechnological applications:

  • Protein Engineering Platform:

    • Development of novel signal peptidase variants with altered substrate specificity

    • Creation of engineered bacterial strains with enhanced secretion capabilities

    • Design of synthetic processing pathways for production of modified lipoproteins

  • Bioremediation Applications:

    • Enhancing the natural capabilities of Beijerinckia indica in degrading aromatic compounds

    • Engineering strains with optimized lspA activity for improved performance in petroleum purification

    • Development of biosensors for environmental monitoring

  • Structural Biology Tools:

    • Use as a model system for studying membrane protein folding and stability

    • Development of new membrane protein crystallization strategies

    • Serving as a template for designing new membrane-active enzymes

  • Agricultural Applications:

    • Enhancing nitrogen fixation capabilities of soil bacteria through optimization of lipoprotein processing

    • Improving plant-microbe interactions by engineering bacterial surface properties

    • Development of novel biofertilizers based on engineered Beijerinckia strains

  • Drug Discovery Platform:

    • Serving as a target for screening antimicrobial compounds

    • Use in structure-based drug design approaches

    • Development of high-throughput assays for inhibitor discovery

How might advances in structural biology techniques contribute to our understanding of Lipoprotein signal peptidase (lspA)?

Advances in structural biology techniques promise to significantly enhance our understanding of Lipoprotein signal peptidase (lspA) in several ways:

  • Cryo-Electron Microscopy (Cryo-EM) Advancements:

    • Single-particle cryo-EM can now achieve near-atomic resolution for membrane proteins

    • Visualization of lspA in different conformational states during the catalytic cycle

    • Structural determination without the need for crystallization, overcoming a major hurdle in membrane protein structural biology

  • Integrative Structural Biology Approaches:

    • Combining multiple techniques (X-ray crystallography, NMR, cryo-EM, mass spectrometry)

    • Cross-validation of structural models through complementary methods

    • Development of more accurate computational models through multi-data integration

  • Time-Resolved Structural Studies:

    • X-ray free-electron lasers (XFELs) for capturing transient states during catalysis

    • Time-resolved cryo-EM to visualize conformational changes

    • Understanding the dynamic aspects of substrate recognition and processing

  • In Situ Structural Biology:

    • Cellular tomography to visualize lspA in its native membrane environment

    • Correlative light and electron microscopy to connect structure with cellular localization

    • Probing protein-protein interactions within the native membrane context

  • Advanced Computational Methods:

    • Improved homology modeling algorithms specific for membrane proteins

    • Machine learning approaches for structure prediction, as has transformed protein structure prediction recently

    • Molecular dynamics simulations in complex membrane environments to understand functional dynamics

What are the key unanswered questions regarding the evolution and function of Lipoprotein signal peptidase (lspA) in different bacterial species?

Several key questions remain unanswered regarding the evolution and function of Lipoprotein signal peptidase (lspA) across bacterial species:

  • Evolutionary Origin and Diversification:

    • What is the evolutionary history of lspA genes across the bacterial kingdom?

    • How have horizontal gene transfer events shaped the distribution and diversity of lspA?

    • What selection pressures have driven the evolution of lspA in different bacterial lineages?

  • Substrate Specificity Determinants:

    • What structural features determine substrate specificity across different bacterial species?

    • How has substrate specificity co-evolved with the lipoprotein repertoire in different bacteria?

    • Are there species-specific recognition motifs beyond the canonical lipobox?

  • Regulatory Networks:

    • How is lspA expression regulated in response to environmental stresses?

    • Are there feedback mechanisms that coordinate lspA activity with lipoprotein synthesis?

    • How does lspA regulation differ between environmental bacteria like Beijerinckia indica and pathogenic species?

  • Functional Diversity:

    • Beyond canonical lipoprotein processing, do lspA proteins have additional functions in different bacterial species?

    • How does lspA function integrate with other cellular processes such as secretion systems?

    • Are there functional connections between lspA and bacterial adaptations to specific ecological niches?

  • Structural Adaptations:

    • How has the structure of lspA adapted to different membrane compositions across bacterial species?

    • Are there structural innovations unique to certain bacterial lineages?

    • What structural features are absolutely conserved, suggesting essential functional roles?

  • Potential for Antimicrobial Development:

    • Are there significant structural differences between lspA from different bacterial groups that could be exploited for species-specific inhibitors?

    • How do bacteria develop resistance to lspA inhibitors?

    • What are the consequences of lspA inhibition in complex bacterial communities?

Addressing these questions will require interdisciplinary approaches combining genomics, structural biology, biochemistry, and evolutionary analyses to fully understand this important bacterial enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.