Recombinant Beijerinckia indica subsp. indica NADH-quinone oxidoreductase subunit K (nuoK)

What is Beijerinckia indica subsp. indica and its ecological significance?

Beijerinckia indica subsp. indica is an aerobic, acidophilic, exopolysaccharide-producing, N₂-fixing soil bacterium that functions as a generalist chemoorganotroph . It belongs to the Rhizobiales order of Alphaproteobacteria and is phylogenetically closely related to facultative and obligate methanotrophs of the genera Methylocella and Methylocapsa . This organism is commonly found as a free-living bacterium in acidic soils and can also establish in plant rhizosphere and phyllosphere environments . The bacterium has received significant research attention due to its plant growth-promoting properties and abundant production of exoheteropolysaccharide with potential biotechnological applications . Its nitrogen-fixing capabilities make it particularly valuable in agricultural contexts where it can enhance soil fertility without chemical fertilizers.

What is NADH-quinone oxidoreductase subunit K (nuoK) and its function in Beijerinckia indica?

NADH-quinone oxidoreductase subunit K (nuoK) is a membrane protein component of the NADH dehydrogenase complex (Complex I) in Beijerinckia indica subsp. indica . The protein has an EC number of 1.6.99.5 and is also referred to as NADH dehydrogenase I subunit K or NDH-1 subunit K . The amino acid sequence of nuoK consists of 102 amino acids: MTVPLTQYLLVAAILFTIGVAGIILNRKNIIIILMSVELILLSVNLNLVAFSASLGDLTGQIFALFILTVAAAEAAIGLAILVTFYRNRGSIAVEDIHMMKG . As a subunit of Complex I, nuoK is likely involved in the first step of the electron transport chain, participating in the transfer of electrons from NADH to quinone and contributing to the generation of a proton gradient across the membrane for ATP synthesis.

How is recombinant nuoK protein stored and handled in laboratory settings?

Recombinant nuoK protein from Beijerinckia indica subsp. indica is typically stored in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein . For short-term storage, the protein can be kept at 4°C for up to one week . For extended storage, it is recommended to store the protein at -20°C or -80°C . Importantly, repeated freezing and thawing cycles should be avoided as they can lead to protein denaturation and loss of activity . Working aliquots should be prepared to minimize the number of freeze-thaw cycles. Additionally, handling should follow standard protein handling protocols, including maintaining sterile conditions and using appropriate protective equipment.

What experimental designs are most effective for studying nuoK function in Beijerinckia indica?

When investigating nuoK function in Beijerinckia indica, researchers should consider both experimental and nonexperimental designs depending on their research questions. For causality studies, the gold standard is an experimental design that can determine the effect of independent variables on dependent variables . Effective experimental designs include:

• Classic Experimental Design: Involving both pretest and posttest measurements with random assignment into experimental and control groups. This design allows for isolation of the treatment effect on nuoK function or expression.

• Posttest-Only Design: Useful when researchers are concerned that pretesting may influence results or when pretesting is impractical. While this design sacrifices some initial baseline data, it still allows for causal inference through comparison with a control group.

• Solomon 4-Group Design: This advanced design combines classic experimentation with posttest-only approaches by using four groups (two experimental, two control) with half receiving pretests. This approach is particularly valuable when studying nuoK expression under different conditions while controlling for potential pretest effects.

For each design, researchers should utilize proper notation, where R denotes random assignment, O represents observations, and X indicates treatment . The choice between these designs should be guided by research goals, with experimental approaches being most appropriate for establishing causal relationships between genetic/environmental factors and nuoK expression or function.

How can researchers resolve contradictions in nuoK expression data between different strains or growth conditions?

When confronted with contradictory data regarding nuoK expression in different strains or growth conditions of Beijerinckia indica, researchers should implement a systematic approach to resolve discrepancies:

• Standardize Experimental Conditions: Ensure that all growth parameters (pH, temperature, media composition) are strictly controlled across experiments. Beijerinckia indica is acidophilic , so pH variations might significantly impact gene expression patterns.

• Employ Multiple Detection Methods: Utilize complementary techniques such as RT-qPCR, western blotting, and proteomics to verify expression data from different angles.

• Sequence Verification: Confirm the genetic sequence of nuoK across different strains to identify potential polymorphisms that might explain functional differences.

• Create a Systematic Data Table: Document all experimental variables as shown below:

• Contextual Analysis: Consider the ecological and metabolic context of nuoK expression, as Beijerinckia indica is known to adapt to different soil conditions and plant associations .

Through this systematic approach, researchers can identify whether contradictions reflect actual biological variation or methodological inconsistencies, leading to a more nuanced understanding of nuoK regulation.

What are the structural and functional relationships between nuoK and other components of the NADH dehydrogenase complex in Beijerinckia indica?

The NADH-quinone oxidoreductase (Complex I) in Beijerinckia indica functions as a large multi-subunit enzyme complex embedded in the cell membrane. The nuoK subunit, with its 102 amino acids, contributes to the membrane domain of this complex. Based on the amino acid sequence (MTVPLTQYLLVAAILFTIGVAGIILNRKNIIIILMSVELILLSVNLNLVAFSASLGDLTGQIFALFILTVAAAEAAIGLAILVTFYRNRGSIAVEDIHMMKG), several key structural features can be identified :

• Membrane Topology: The sequence suggests multiple transmembrane helices with hydrophobic residue patterns typical of membrane-spanning domains.

• Functional Domains: The C-terminal region (RGSIAVEDIHMMKG) likely participates in interactions with other subunits or in electron transfer functions.

• Conservation Analysis: Comparison with nuoK from related organisms reveals conserved regions critical for function:

To investigate these structural-functional relationships experimentally, researchers should consider:

• Site-directed mutagenesis of conserved residues

• Cross-linking studies to map interactions with other complex subunits

• Cryo-EM analysis of the entire complex structure

• Comparative genomics with related bacteria like Methylocella and Methylocapsa

Understanding these relationships is crucial for elucidating how nuoK contributes to energy metabolism in this agriculturally important nitrogen-fixing bacterium.

What are the optimal conditions for expressing recombinant nuoK in heterologous systems?

Expression of recombinant nuoK from Beijerinckia indica in heterologous systems requires careful optimization of conditions to obtain functional protein. Based on the characteristics of this membrane protein and the source organism, researchers should consider:

• Expression System Selection:

  • E. coli-based systems with modified membranes may be suitable for initial studies

  • Alternative hosts like Pichia pastoris might better accommodate membrane proteins

  • Cell-free systems can be considered for difficult-to-express membrane proteins

• Expression Vector Design:

  • Include appropriate fusion tags that will be determined during the production process

  • Consider codon optimization based on the Beijerinckia indica genome, which was fully sequenced in 2010

  • Engineer construct with inducible promoters for controlled expression

• Culture Conditions:

  • Lower temperature (16-20°C) during induction to slow protein synthesis and improve folding

  • Optimize media pH considering Beijerinckia indica's acidophilic nature (pH 5.0-6.0)

  • Supplement with appropriate carbon sources that mimic natural conditions

• Extraction and Purification:

  • Use specialized detergents for membrane protein solubilization

  • Implement a purification strategy compatible with the determined tag system

  • Store in optimized Tris-based buffer with 50% glycerol as indicated in product specifications

The expression region should encompass the full-length protein (positions 1-102) to ensure complete functional capacity . Successful expression will likely require iterative optimization of these parameters specific to the chosen expression system.

How can researchers effectively design experiments to study the role of nuoK in nitrogen fixation and plant growth promotion?

Designing experiments to investigate the relationship between nuoK function and Beijerinckia indica's nitrogen fixation and plant growth promotion requires a multidisciplinary approach:

• Gene Knockout/Knockdown Studies:

  • Generate nuoK mutants using modern genome editing techniques

  • Compare nitrogen fixation rates between wild-type and mutant strains using acetylene reduction assays

  • Assess plant growth promotion capabilities in controlled greenhouse experiments

• Field Experimental Design:

  • Implement randomized complete block designs with multiple treatments as demonstrated in previous studies with Beijerinckia

  • Include control groups, biofertilizer treatments, and varying application rates (e.g., 50%, 100%, and 150% of recommended rates)

  • Monitor both bacterial performance and plant response parameters

• Measurable Outcomes:

  • Track changes in soil chemical properties (available N, P, K) before and after bacterial application

  • Measure plant growth parameters including yield, height, and nutrient uptake

  • Analyze bacterial colonization patterns in rhizosphere using molecular techniques

• Integration with Biofertilizer Studies:

  • Build on previous research showing Beijerinckia indica's effectiveness when combined with organic matter in biofertilizer applications

  • Investigate whether nuoK expression levels correlate with improved plant growth outcomes

  • Compare effectiveness with conventional fertilizers as benchmarks

Researchers should consider potential interactions with other microorganisms, such as the fungus Cunninghamella elegans, which has shown synergistic effects with Beijerinckia indica in previous studies . This comprehensive experimental approach will help elucidate the specific contributions of nuoK to the bacterium's beneficial agricultural properties.

What analytical techniques are most appropriate for assessing nuoK activity and its contribution to cellular energetics?

To accurately assess nuoK activity and its contribution to cellular energetics in Beijerinckia indica, researchers should employ multiple complementary analytical techniques:

• Enzyme Activity Assays:

  • NADH:ubiquinone oxidoreductase activity measurements using spectrophotometric methods

  • Polarographic oxygen consumption analysis in membrane preparations

  • Specific inhibitor studies (e.g., rotenone, piericidin A) to distinguish Complex I activity

• Membrane Potential Analysis:

  • Fluorescent probe measurements (e.g., DiSC3(5), JC-1) to monitor membrane potential changes

  • Patch-clamp techniques for direct measurement of proton translocation

  • Ion-selective microelectrodes to track proton gradient formation

• Advanced Biophysical Techniques:

  • Electron paramagnetic resonance (EPR) spectroscopy to monitor electron transfer reactions

  • Surface plasmon resonance to study protein-protein interactions within the complex

  • Isothermal titration calorimetry for binding energetics of cofactors

• In vivo Energetic Analysis:

  • Real-time ATP measurements using luciferase-based reporters

  • NAD+/NADH ratio determination in wild-type versus nuoK-modified strains

  • Metabolic flux analysis using isotope-labeled substrates

• Data Integration Framework:

By integrating these techniques, researchers can build a comprehensive understanding of how nuoK contributes to Beijerinckia indica's energy metabolism, which ultimately supports its nitrogen fixation capabilities and plant growth promotion effects .

How does nuoK expression and function in Beijerinckia indica compare with homologs in related nitrogen-fixing and methanotrophic bacteria?

Comparative analysis of nuoK across related bacterial species provides valuable evolutionary and functional insights. Beijerinckia indica subsp. indica is phylogenetically related to facultative and obligate methanotrophs of the genera Methylocella and Methylocapsa , creating an interesting comparative framework:

• Sequence Conservation Analysis:

  • Core transmembrane domains show high conservation across the Rhizobiales order

  • Species-specific variations occur primarily in loop regions

  • Critical functional residues for proton pumping remain invariant

• Expression Pattern Differences:

  • In Beijerinckia indica, nuoK expression likely correlates with nitrogen fixation activities

  • In methanotrophic relatives, expression may be coupled to methane oxidation pathways

  • Regulatory elements controlling nuoK often differ between nitrogen fixers and methanotrophs

• Functional Adaptations:

  • Acidophilic adaptations in Beijerinckia-specific nuoK residues support function in low pH soils

  • Methanotroph homologs may show optimizations for different electron donor utilization

  • Nitrogen-fixing species show nuoK adaptations that balance energy efficiency with nitrogenase demands

Understanding these comparative aspects can guide genetic engineering efforts to enhance nitrogen fixation efficiency or expand the metabolic capabilities of these agriculturally important bacteria.

What role might nuoK play in the adaptation of Beijerinckia indica to various environmental conditions?

As a component of the NADH dehydrogenase complex, nuoK is likely central to Beijerinckia indica's ability to adapt to changing environmental conditions:

• pH Adaptation:

  • The acidophilic nature of Beijerinckia indica suggests nuoK has evolved to maintain proton gradient integrity at low pH

  • Specific amino acid composition in transmembrane regions may buffer against external pH fluctuations

  • Experimental evidence suggests optimal function in acidic soils where other nitrogen fixers may struggle

• Carbon Source Flexibility:

  • nuoK function supports energetic needs when utilizing various carbon sources

  • The generalist chemoorganotrophic lifestyle of Beijerinckia requires flexible electron transport chains

  • When applied with organic matter like earthworm compost or ice cream waste , nuoK activity likely adapts to process diverse carbon compounds

• Agricultural Environment Adaptation:

  • Field studies demonstrate Beijerinckia's effectiveness in various soil types

  • nuoK may play a role in energy conservation during plant association versus free-living states

  • Experimental data from biofertilizer applications suggests robust adaptation to rhizosphere conditions

This adaptive flexibility makes nuoK an interesting target for research into bacterial resilience and environmental adaptation, with implications for improving biofertilizer performance across diverse agricultural settings.