Recombinant Beijerinckia indica subsp. indica Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Genomic and Proteomic Characteristics

Genomic Context
Beijerinckia indica subsp. indica ATCC 9039 is an acidophilic, exopolysaccharide-producing bacterium with a 4.17 Mbp genome and two plasmids (181,736 bp and 66,727 bp) . The crcB gene is part of a metabolic operon associated with fluoride riboswitches, which regulate gene expression in response to fluoride exposure .

FeatureDetail
Genome AssemblyNC_010581 (chromosome), NC_010580 and NC_010578 (plasmids)
Gene FunctionPredicted fluoride transporter (membrane protein superfamily)
Protein LengthPartial sequence data; homologs in other species vary in amino acid sequence
Recombinant AvailabilityAvailable as recombinant protein (e.g., MyBioSource MBS7066473)

Functional Roles

Fluoride Resistance
CrcB homologs are critical for reducing intracellular fluoride concentrations. In E. coli, crcB knockout strains exhibit fluoride sensitivity, while heterologous expression of Beijerinckia CrcB rescues growth under high fluoride conditions . This suggests a conserved role in fluoride efflux.

Transcriptional Regulation
Fluoride riboswitches upstream of crcB regulate gene expression by modulating transcription or translation. In Bacillus cereus, the crcB riboswitch activates a reporter gene in the presence of fluoride .

Research Findings

Mechanistic Insights

  • Fluoride Binding: Fluoride-responsive riboswitches linked to crcB undergo structural changes with a K<sub>D</sub> ~60 μM, enabling ligand detection .

  • Protein Function: CrcB belongs to a transporter superfamily, with homologs (e.g., Pseudomonas syringae EriC F) demonstrating functional equivalence in fluoride resistance .

Genetic and Physiological Studies

OrganismKey FindingSource
E. colicrcB KO strains show impaired growth at 50 mM fluoride
Bacillus cereuscrcB riboswitch activates lacZ expression in the presence of fluoride
Beijerinckia indicaGenome lacks methanotrophy pathways but retains broad metabolic versatility

Applications and Significance

Biotechnological Potential

  • Fluoride Detoxification: CrcB homologs could enable engineered bacteria to thrive in fluoride-contaminated environments.

  • Stress Response Models: Studies on CrcB provide insights into bacterial adaptation to toxic anions, relevant for bioremediation and industrial biotechnology.

Research Gaps

  • Structural characterization of CrcB remains limited; no crystallographic data exist for Beijerinckia CrcB .

  • Dual roles in transcriptional regulation and fluoride transport require further validation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
crcB; Bind_1311; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712)
Target Names
crcB
Target Protein Sequence
MRDSLLVFCGAGLGGLLRHGLNQVSLRLALFGFPWMTCFINISGSLAMGLLVGYLAGHGD SRFPQSLRLFLATGVLGGYTTFSTFSLENALLIERGAVGLAVLYSLVSVGLGLGGLFLGL TLTRSLS
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration and its associated toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does CrcB relate to fluoride resistance mechanisms?

CrcB proteins play a crucial role in fluoride resistance by exporting fluoride ions from the cell. Studies using genetic knockouts have demonstrated that bacteria lacking functional crcB genes show significantly increased sensitivity to fluoride. For example, an E. coli strain with a crcB gene knockout could not grow at 50 mM fluoride concentration and exhibited high reporter gene expression even at low (0.2 mM) fluoride concentrations .

Growth curves analysis comparing wild-type and crcB knockout cells at various fluoride concentrations have shown that:

  • Reporter gene expression increases proportionally to fluoride concentration in the media until reaching toxic levels

  • Both growth inhibition and reporter gene expression phenotypes shift to lower fluoride concentrations in crcB knockout cells

  • CrcB protein expression helps maintain cell viability in fluoride-rich environments

What approaches can be used to express recombinant CrcB proteins in laboratory settings?

Expression of recombinant CrcB proteins can be optimized using multivariant analysis and design of experiments (DoE) methodologies. Unlike traditional univariant methods that change one variable at a time, multivariant methods allow researchers to:

  • Characterize experimental error

  • Compare effects of variables between themselves when variables are normalized

  • Gather high-quality information with minimal experiments

To express recombinant CrcB in E. coli, researchers should consider the following strategies:

  • Use a fractional factorial screening design to assess effects of key variables, including:

    • Induction time (optimal timing often between 4-6 hours)

    • Media composition

    • Inducer concentration

    • Temperature

    • pH

    • Oxygen transfer rate

  • For membrane proteins like CrcB, solubility considerations are crucial. Statistical experimental design methodology can help achieve high concentrations of soluble protein (e.g., 250 mg/L) .

How can researchers design experiments to study CrcB function in relation to fluoride transport?

Experimental designs to study CrcB function should include:

  • Growth inhibition assays: Compare wild-type and crcB knockout strains at various fluoride concentrations. For example, the minimal inhibitory concentration (MIC) determination protocol for Pseudomonas putida involves:

    • Diluting cells 20× in modified M9 minimal medium with different NaF concentrations

    • Growing cells in 96-well microtiter plates at 30°C

    • Monitoring OD600 readings every 30 minutes for 24 hours

    • Using OD600 values after 20 hours to calculate MICs

  • Fluoride transport assays: Measure intracellular versus extracellular fluoride concentrations using fluoride-specific electrodes or fluorescent probes.

  • Reporter gene assays: Construct fluoride riboswitch-reporter gene fusions to monitor CrcB-mediated changes in intracellular fluoride levels.

A robust experimental design should include appropriate controls:

  • Positive control: Known fluoride transporter

  • Negative control: Knockout strain or strain expressing non-functional CrcB

  • Complementation: Knockout strains complemented with functional CrcB

How do fluoride riboswitches regulate crcB expression, and how can this system be utilized in experimental designs?

Fluoride riboswitches (formerly called crcB RNA motifs) are conserved RNA structures that sense fluoride ions and regulate the expression of genes that mitigate fluoride toxicity, including crcB genes .

The mechanism of fluoride riboswitch function involves:

  • Conformational changes: The highly conserved nucleotides of the CrcB motif dramatically change conformation in the presence of NaF, as observed using in-line probing methods .

  • Transcriptional regulation: When fluoride binds to the aptamer domain, it leads to the formation of an anti-terminator stem that allows RNA polymerase access, activating transcription. In the absence of fluoride, the riboswitch forms a terminator stem that stops transcription .

  • Structural details: The fluoride riboswitch includes a four-base-pair pseudoknot and two single-base-pair pseudoknots. The fluoride ion is coordinated by three Mg²⁺ ions, which are themselves coordinated by water and the ribose-phosphate backbone .

Researchers can utilize the fluoride riboswitch as a tool for dampening gene expression in experimental systems, particularly when working with potentially toxic proteins or potent promoters. The fluoride riboswitch can be inserted between a promoter and a reporter gene to control expression levels . This approach offers several advantages:

  • It allows for cloning and transformation of constructs that might otherwise be toxic

  • Expression levels can be modulated by adjusting fluoride concentration

  • The system works in multiple bacterial species including E. coli and Burkholderia thailandensis

What structural features of CrcB contribute to its function as a fluoride transporter?

The structure-function relationship of CrcB proteins involves several key elements:

  • CrcB proteins are membrane proteins with multiple membrane-spanning regions .

  • The protein from Beijerinckia indica subsp. indica is 127 amino acids long with hydrophobic regions consistent with transmembrane domains .

  • The amino acid sequence reveals highly conserved motifs across different species, suggesting common mechanisms of fluoride transport .

In the Beijerinckia indica CrcB homolog, the sequence analysis reveals:

  • Several glycine-rich regions that may contribute to structural flexibility

  • Hydrophobic stretches corresponding to potential membrane-spanning segments

  • Conserved residues that may participate in fluoride ion binding or channel formation

Research using X-ray crystallography and cryo-electron microscopy would be valuable to determine the precise three-dimensional structure and transport mechanism.

What are the common challenges in working with recombinant CrcB proteins and how can they be addressed?

Working with recombinant membrane proteins like CrcB presents several challenges:

  • Protein solubility issues:

    • Challenge: CrcB is a membrane protein and may form inclusion bodies when overexpressed.

    • Solution: Optimize expression conditions using DoE approaches to maximize soluble expression. Parameters to optimize include temperature (often lowered to 16-25°C), inducer concentration, and use of solubility enhancing tags .

  • Protein purification difficulties:

    • Challenge: Membrane proteins require detergents for extraction and purification.

    • Solution: Screen different detergents (mild non-ionic detergents like DDM or LMNG) for optimal extraction while maintaining protein function. Consider adding stabilizing agents like glycerol to buffers .

  • Functional assessment:

    • Challenge: Verifying that the recombinant protein retains fluoride transport activity.

    • Solution: Develop fluoride-specific functional assays or complementation studies in crcB knockout strains .

How can quasi-experimental designs be employed to study CrcB function in complex biological systems?

Quasi-experimental designs can be particularly valuable for studying CrcB in complex biological systems where fully randomized controlled trials may not be feasible. Key approaches include:

  • Pre-post designs with non-equivalent control groups:

    • Compare CrcB function in different bacterial strains or under different environmental conditions

    • Account for pre-existing differences between treatment and control groups that could be erroneously attributed to the intervention

  • Interrupted time series (ITS) designs:

    • Monitor changes in fluoride resistance or CrcB expression over time, with measurements taken at regular intervals before and after an intervention

    • This can help identify trends and intervention effects while controlling for secular trends

  • Optimization trials:

    • Use factorial or fractional-factorial designs to evaluate multiple components of CrcB function simultaneously

    • These designs randomize participants to different combinations of factors to determine optimal conditions

When implementing quasi-experimental designs, researchers should:

  • Clearly define the research question and target population

  • Consider inclusion criteria that impact generalizability

  • Use statistical approaches to improve internal validity (e.g., propensity scores)

  • Link health claims or phenotypic data to genetic or molecular data when possible

What statistical approaches are most appropriate for analyzing CrcB-related experimental data?

The statistical analysis of CrcB-related experiments should be tailored to the specific experimental design:

  • For DoE in recombinant protein expression:

    • Analysis of variance (ANOVA) to determine statistically significant factors

    • Response surface methodology (RSM) to optimize multiple factors simultaneously

    • Principal component analysis to reduce dimensionality when many variables are studied

  • For growth inhibition studies:

    • Non-linear regression to determine IC50 values (concentration causing 50% growth inhibition)

    • Two-way ANOVA to assess interactions between strains and fluoride concentrations

    • Survival analysis techniques for time-to-event data

  • For fluoride transport studies:

    • Michaelis-Menten kinetics to determine transport parameters (Km, Vmax)

    • Linear mixed models to account for repeated measures and hierarchical data structures

When dealing with genetic variant studies related to CrcB:

  • Consider Cox proportional hazards regression for time-to-event data

  • Adjust for confounding variables including age, sex, and genetic background

  • Include interaction terms to investigate effect modification by environmental factors

How can researchers reconcile contradictory data on CrcB function across different experimental systems?

Reconciling contradictory data on CrcB function requires systematic investigation of potential sources of variation:

When faced with contradictory data, conduct meta-analysis or systematic reviews that:

  • Explicitly state inclusion/exclusion criteria

  • Assess study quality using standardized tools

  • Evaluate publication bias

  • Use appropriate methods for pooling results across studies

What are the emerging areas of research involving CrcB and fluoride resistance mechanisms?

Several promising research directions are emerging in the field of CrcB and fluoride resistance:

  • Structural biology approaches:

    • Determination of high-resolution structures of CrcB proteins using cryo-EM or X-ray crystallography

    • Structure-guided design of inhibitors or modulators of CrcB function

  • Systems biology integration:

    • Network analysis of fluoride resistance mechanisms and their integration with other stress responses

    • Multi-omics approaches (genomics, transcriptomics, proteomics) to understand the broader cellular response to fluoride stress

    • Investigation of how fluoride resistance mechanisms interact with other metabolic pathways

  • Evolutionary perspectives:

    • Comparative genomics of CrcB across diverse species to understand evolutionary adaptation to fluoride

    • Investigation of horizontal gene transfer patterns of fluoride resistance genes

    • Reconstruction of the evolutionary history of fluoride riboswitches and their target genes

  • Innovative applications:

    • Development of fluoride-responsive genetic circuits using engineered fluoride riboswitches

    • Potential applications in synthetic biology for controlled gene expression

    • Use of CrcB-fluoride riboswitch systems as biosensors for environmental fluoride detection

How might research on CrcB proteins contribute to our understanding of membrane transport mechanisms and riboswitch function?

Research on CrcB proteins offers unique opportunities to advance our understanding of:

  • Selective ion transport mechanisms:

    • CrcB represents a specialized transporter for the highly electronegative fluoride ion

    • Understanding how CrcB achieves selectivity for fluoride over other anions like chloride can inform general principles of ion selectivity

    • The coordination chemistry and transport pathway for fluoride could reveal novel membrane transport mechanisms

  • Riboswitch biology:

    • The fluoride riboswitch exemplifies how RNA structures can selectively sense small ions

    • The fluoride riboswitch-CrcB system demonstrates co-evolution of regulatory RNA and protein coding sequences

    • This system provides insights into how riboswitches can control gene expression at both transcriptional and translational levels

  • Stress response integration:

    • CrcB-mediated fluoride resistance illustrates how specific stress responses are integrated into cellular physiology

    • This research can reveal principles of how cells prioritize and coordinate responses to multiple stressors

    • Understanding the regulatory network involving CrcB can inform broader principles of bacterial adaptation to environmental challenges

  • Methodological advances:

    • The study of CrcB proteins has driven innovation in experimental approaches for membrane proteins

    • The development of fluoride-responsive genetic tools has applications beyond the study of CrcB itself

    • The integration of structural, functional, and evolutionary approaches provides a model for comprehensive study of other membrane transport systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.