Recombinant Berne virus Membrane protein (M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
M; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Berne virus (BEV)
Target Names
M
Target Protein Sequence
MFETNYWPFPDQAPNPFTAQIEQLTATENVYIFLTTLFGILQLVYVMFKLLCTMFPSLHF SPIWRGLENFWLFLSLASLAIAYWWLPSMTFTGYWALTIIATILVFILLIMMFVKFVNFV KLFYRTGSFAIAIRGPIVLVALDVTIKLHCTPFAILVKEIGNIFYLSEYCNKPLTAAQIA ALRICVNGQWFAYTRSSTTSAARVAAANSTAKYHLFVLQGVAEYTQLSSVKFE
Uniprot No.

Target Background

Function

A viral envelope component crucial for virus morphogenesis and assembly through interactions with other viral proteins.

Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What experimental approaches should be considered when studying the topology of recombinant Berne virus M protein in membranes?

    To investigate the membrane topology of recombinant Berne virus M protein, researchers should employ multiple complementary approaches:

    1. In vitro translation with microsomes: Perform cell-free translation in the presence of microsomal membranes, followed by proteinase K digestion to determine which portions are protected by the membrane.

    2. Hybrid protein construction: Create chimeric proteins with known epitopes or reporter proteins attached to different domains, as demonstrated with the EM hybrid containing the C-terminal tail of coronavirus M protein.

    3. Site-directed mutagenesis: Introduce or remove potential glycosylation sites at different positions to determine which regions are lumenal.

    4. Fluorescence protease protection (FPP) assay: For live cell studies, express the protein with fluorescent tags and determine which portions are accessible to proteases.

    5. Cysteine accessibility methods: Introduce cysteine residues at various positions and assess their accessibility to membrane-impermeable sulfhydryl reagents.

    These combined approaches can provide a comprehensive understanding of how the protein is oriented within cellular membranes .

  • How do mutations in the transmembrane domains of Berne virus M protein affect its functionality and localization?

    Mutations in the transmembrane domains can significantly impact functionality and localization of the Berne virus M protein. Based on studies of similar proteins:

    Mutation TypeImpact on LocalizationImpact on FunctionMechanism
    Hydrophobic residue alterationsDisruption of ER retentionDecreased viral assemblyAltered membrane anchoring
    Charged residue modificationsMisdirection to plasma membraneLoss of interaction with other viral proteinsDisruption of charge interactions
    Helix-breaking substitutionsProtein misfolding and degradationComplete loss of functionStructural destabilization
    Conserved motif alterationsVariable depending on specific motifOften affects protein-protein interactionsDisruption of binding interfaces

    The three transmembrane α-helices form a tightly packed bundle that is critical for proper folding, localization, and function. Disruption of this structure through mutations typically leads to impaired viral assembly, highlighting the essential role of these domains in the viral life cycle .

  • What are the best approaches for optimizing the yield and purity of recombinant Berne virus M protein for structural studies?

    Optimizing recombinant Berne virus M protein production for structural studies requires addressing several challenges inherent to membrane proteins:

    1. Expression systems:

      • HEK293 mammalian cells have proven effective for coronavirus M proteins and likely for Berne virus M protein

      • Compare yield and proper folding across multiple systems (E. coli, baculovirus, yeast)

    2. Solubilization strategies:

      • Test multiple detergents (LMNG/CHS, GDN, DDM) for optimal extraction while maintaining native structure

      • Consider nanodiscs or amphipols for detergent-free purification

    3. Purification protocol:

      • Implement two-step affinity chromatography using N-terminal tags (His, FLAG)

      • Follow with size-exclusion chromatography to isolate monomeric/dimeric forms

    4. Protein stabilization:

      • Identify lipids that stabilize the protein structure

      • Investigate buffer conditions (pH, salt, additives) that enhance stability

    5. Quality assessment:

      • Verify protein homogeneity by analytical ultracentrifugation

      • Confirm structural integrity by circular dichroism or thermal shift assays

    This systematic approach can significantly improve yield and purity while maintaining the native structure required for valid structural analysis .

  • How can I effectively design immunization studies to evaluate the immunogenicity of recombinant Berne virus M protein?

    Designing effective immunization studies for recombinant Berne virus M protein requires careful consideration of several factors:

    1. Antigen preparation:

      • Use properly folded, purified recombinant protein

      • Consider incorporating the protein into proteoliposomes to maintain native conformation

      • Combine with appropriate adjuvants (e.g., lipid A) to enhance immune response

    2. Immunization protocol:

      • Implement a multi-dose strategy (e.g., three injections at 2-week intervals)

      • Compare different administration routes (subcutaneous, intraperitoneal, intranasal)

      • Include appropriate control groups (vehicle only, irrelevant protein)

    3. Immune response assessment:

      • Measure antibody titers using enzyme-linked immunosorbent assay (ELISA)

      • Evaluate antibody specificity through Western blotting

      • Assess neutralizing activity using neutralization assays

      • Analyze T-cell responses via ELISpot or intracellular cytokine staining

    4. Epitope mapping:

      • Use peptide arrays to identify immunodominant regions

      • Employ competition assays to characterize antibody binding sites

      • Consider phage display techniques for detailed epitope analysis

    5. Cross-reactivity analysis:

      • Test sera against related viral proteins to assess specificity

      • Evaluate potential for cross-protection against related viruses

    This comprehensive approach will provide robust data on the immunogenic properties of recombinant Berne virus M protein and its potential for vaccine development .

  • What role does Berne virus M protein play in virus assembly compared to other viral membrane proteins?

    The Berne virus M protein, like coronavirus M proteins, plays a central role in viral assembly and morphogenesis. Current research indicates:

    1. Orchestration of assembly:

      • Acts as the main organizer of viral assembly

      • Creates a scaffold for the incorporation of other viral components

      • Mediates membrane curvature necessary for virion formation

    2. Protein-protein interactions:

      • Interacts with nucleocapsid (N) protein, facilitating genome packaging

      • Forms complexes with envelope (E) protein to create the viral envelope

      • May assist in spike (S) protein incorporation into virions

    3. Conformational dynamics:

      • Likely exists in multiple conformational states (similar to coronavirus M protein's "long" and "short" forms)

      • These conformational changes appear critical for proper assembly

      • Transmembrane domain swapping between protomers contributes to assembly

    4. Membrane modification:

      • Induces membrane curvature through its mushroom-shaped structure

      • Oligomerization likely contributes to membrane remodeling

      • The highly conserved hinge region enables conformational flexibility needed for assembly

    Understanding these mechanisms provides insights into torovirus assembly and potential targets for antiviral development .

  • How can I develop screening assays for inhibitors targeting the Berne virus M protein?

    Developing effective screening assays for Berne virus M protein inhibitors requires multiple complementary approaches:

    1. Biochemical interaction assays:

      • Fluorescence polarization assays to detect compound binding to purified M protein

      • Thermal shift assays to identify compounds that stabilize specific conformations

      • Surface plasmon resonance to measure binding kinetics and affinity

    2. Structural stabilization screening:

      • Design assays to identify compounds that lock the M protein in a single conformation (similar to JNJ-9676 or CIM-834 for SARS-CoV-2)

      • Monitor protein conformational states using intrinsic fluorescence or FRET-based sensors

    3. Functional assays:

      • Virus-like particle (VLP) formation assays to assess inhibition of assembly

      • Protein-protein interaction assays to identify compounds that disrupt M-N or M-E interactions

      • Split-luciferase complementation to monitor protein interactions in live cells

    4. Cellular imaging approaches:

      • High-content screening to visualize changes in M protein localization

      • Transmission electron microscopy to directly observe effects on virion formation

    5. Validation strategies:

      • Cryo-EM analysis to confirm binding mode of hit compounds

      • Mutagenesis of predicted binding sites to confirm mechanism of action

      • In vitro viral replication assays to verify antiviral activity

    By implementing this multi-layered screening cascade, researchers can identify and characterize compounds that specifically target the Berne virus M protein and potentially develop novel antivirals .

  • What are the key considerations when designing recombinant Berne virus M protein constructs for functional studies?

    When designing recombinant Berne virus M protein constructs for functional studies, researchers should consider:

    1. Expression vector selection:

      • For mammalian expression, vectors with strong promoters (CMV, CAG) are recommended

      • Include appropriate signal sequences if needed for membrane targeting

      • Consider inducible expression systems for potentially toxic constructs

    2. Fusion tag strategies:

      • N-terminal tags: May affect membrane insertion; keep minimal (e.g., small epitope tags)

      • C-terminal tags: Generally better tolerated for detection and purification

      • Consider cleavable tags (TEV protease sites) for tag removal

    3. Domain preservation:

      • Maintain intact transmembrane domains (residues 9-105 in similar proteins)

      • Preserve the critical hinge region (residues 106-116 in coronavirus M)

      • Keep C-terminal domain (residues 117-201) intact for protein-protein interactions

    4. Mutagenesis approaches:

      • Alanine scanning of key residues for structure-function analysis

      • Conservative substitutions to maintain structural integrity

      • Domain swapping with related viral proteins to create chimeras for functional mapping

    5. Codon optimization:

      • Adapt codons for the expression system of choice

      • Avoid rare codons that may limit expression

      • Consider removing regulatory sequences that might affect expression

    These design principles will help ensure the recombinant protein maintains proper folding, localization, and functionality, yielding more reliable experimental results .

  • How does glycosylation affect the structure and function of recombinant Berne virus M protein?

    Glycosylation plays a significant role in Berne virus M protein structure and function:

    1. Glycosylation patterns:

      • N-terminal domain likely contains N-glycosylation sites

      • May undergo complex modifications similar to coronavirus M proteins

      • Polylactosamine chains might be conjugated to the protein

    2. Structural impacts:

      Glycosylation StateEffect on StructureImpact on Function
      Fully glycosylatedEnhanced stability, proper foldingOptimal virus assembly
      Partially glycosylatedVariable conformational statesReduced assembly efficiency
      Non-glycosylatedPotential misfoldingImpaired viral particle formation
    3. Functional significance:

      • May influence protein-protein interactions during viral assembly

      • Could affect immune recognition and antigenicity

      • Likely important for proper trafficking within the cell

    4. Experimental considerations:

      • Expression systems differ in glycosylation capability (mammalian preferred)

      • Mutations of glycosylation sites can be used to assess functional importance

      • Enzymatic deglycosylation can help determine structure-function relationships

    5. Evolutionary context:

      • Conservation of glycosylation sites suggests functional importance

      • Differences in glycosylation between viral species may reflect host adaptation

    Understanding these glycosylation effects is crucial for producing functionally relevant recombinant proteins and for developing potential therapeutic strategies targeting viral assembly .

Methodological Questions

  • What are the optimal conditions for long-term storage of purified recombinant Berne virus M protein?

    Establishing optimal storage conditions for purified recombinant Berne virus M protein is critical for maintaining its structural integrity and functionality:

    1. Buffer composition:

      • Maintain physiological pH (7.0-7.5) using phosphate or Tris buffers

      • Include stabilizing agents: 10% glycerol, 1-5 mM DTT or TCEP

      • Add appropriate salt concentration (150-300 mM NaCl) to prevent aggregation

      • Consider adding specific lipids that stabilize membrane protein structure

    2. Storage temperature:

      • Short-term (1-2 weeks): 4°C with preservatives (0.02% sodium azide)

      • Medium-term (1-6 months): -20°C in buffer containing 50% glycerol

      • Long-term (>6 months): -80°C as flash-frozen aliquots

    3. Preparation methods:

      • Divide into small single-use aliquots to avoid freeze-thaw cycles

      • Flash freeze in liquid nitrogen for rapid freezing

      • Consider lyophilization for very long-term storage

    4. Quality control protocols:

      • Perform periodic stability tests (SDS-PAGE, Western blot)

      • Monitor aggregation by dynamic light scattering

      • Assess functionality through binding assays before experimental use

    5. Reconstitution approaches:

      • For detergent-solubilized protein: Thaw slowly at 4°C with gentle mixing

      • For lyophilized protein: Reconstitute in original buffer with detergent

      • Allow complete equilibration before use (generally 1-2 hours at 4°C)

    These strategies will help maintain protein integrity and experimental reproducibility during long-term storage .

  • How can I effectively design cryo-EM studies to determine the structure of recombinant Berne virus M protein?

    Designing effective cryo-EM studies for recombinant Berne virus M protein requires careful planning to address challenges specific to membrane proteins:

    1. Sample preparation optimization:

      • Achieve high protein concentration (1-5 mg/ml) without aggregation

      • Test multiple detergents (LMNG/CHS, GDN) for optimal micelle properties

      • Consider nanodiscs or amphipols to improve particle visibility

      • Evaluate grid types (Quantifoil, C-flat) and hole sizes for optimal distribution

    2. Stabilization strategies:

      • Generate Fab fragments from monoclonal antibodies to stabilize specific conformations

      • Screen for small molecules that lock the protein in defined states

      • Incorporate specific lipids that promote stability

      • Consider limited cross-linking to prevent dissociation

    3. Data collection parameters:

      • Use energy filters to improve contrast (20 eV slit width)

      • Collect at high magnification (≥50,000×) for sufficient resolution

      • Implement motion correction and dose-weighting

      • Use appropriate defocus range (-0.8 to -2.5 μm)

    4. Processing workflow:

      • Classify particles to identify different conformational states

      • Apply symmetry (likely C2) when appropriate

      • Use focused refinement for flexible regions

      • Validate results with multiple processing approaches

    5. Validation and interpretation:

      • Compare with structures of related proteins (coronavirus M proteins)

      • Correlate structure with functional data

      • Confirm key features with mutagenesis studies

    This comprehensive approach can help overcome the challenges of membrane protein structural determination and provide valuable insights into Berne virus M protein structure and function .

  • What are the key experimental controls needed when studying protein-protein interactions involving recombinant Berne virus M protein?

    When investigating protein-protein interactions of recombinant Berne virus M protein, robust experimental controls are essential:

    1. Positive interaction controls:

      • Include known protein pairs with established interaction patterns

      • Use hybrid proteins with validated binding domains (e.g., EM protein containing coronavirus M C-terminal tail)

      • Incorporate positive control constructs in parallel experimental setups

    2. Negative interaction controls:

      • Test unrelated proteins of similar size/properties

      • Use truncated or mutation-containing constructs predicted to disrupt binding

      • Include non-homologous viral proteins from different virus families

    3. Methodological controls:

      • For pull-down assays: Include beads-only and tag-only conditions

      • For co-immunoprecipitation: Use isotype-matched irrelevant antibodies

      • For FRET/BRET: Test donor-only and acceptor-only conditions

    4. Specificity validation strategies:

      • Competition assays with unlabeled protein

      • Dose-response titrations to demonstrate specificity

      • Domain mapping to identify critical interaction regions

    5. Cell-based interaction controls:

      • Conduct parallel experiments in multiple cell types

      • Compare membrane vs. cytosolic protein fractions

      • Assess interactions under various cellular conditions (stress, infection)

    6. Validation across different methods:

      MethodComplementary ApproachControl Type
      Co-IPPull-down assayOrthogonal method
      Y2HMammalian 2-hybridSystem-specific
      FRETBiFCProximity-based
      SPRITCBiophysical

    These comprehensive controls ensure that observed interactions are specific, reproducible, and biologically relevant .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.