Recombinant Berylmys bowersi Cytochrome c oxidase subunit 2 (MT-CO2)

What is Berylmys bowersi Cytochrome c oxidase subunit 2 (MT-CO2)?

Berylmys bowersi Cytochrome c oxidase subunit 2 (MT-CO2) is a mitochondrially-encoded protein that serves as one of the core subunits of cytochrome c oxidase (COX), the terminal enzyme complex in the electron transport chain. MT-CO2 is also referred to as Cytochrome c oxidase polypeptide II in scientific literature . The protein is crucial for cellular respiration, playing a significant role in the physiological processes of energy production. MT-CO2 from Berylmys bowersi (Bower's white-toothed rat) has been characterized at the molecular level and is registered in the UniProt database with the accession number Q38S20 .

What is the complete amino acid sequence of Berylmys bowersi MT-CO2?

The complete amino acid sequence of Berylmys bowersi MT-CO2 consists of 227 amino acid residues as follows:

MAYPFQLGLQDATSPIMEELTNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAVILILIALPSLRILYMMDEINNPALTVKTMGHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKHFENWSASMI

This sequence information is essential for researchers conducting comparative analyses, structural studies, and recombinant protein production. When designing experiments involving this protein, researchers should consider the specific properties derived from this primary structure.

How does MT-CO2 contribute to electron transport in cellular respiration?

MT-CO2 plays a critical role in cellular respiration by facilitating the initial transfer of electrons from cytochrome c to the cytochrome c oxidase complex, which is crucial for ATP production . The protein contains a dual core CuA active site that functions as the primary electron acceptor from reduced cytochrome c molecules . This electron transfer initiates a cascade within the cytochrome c oxidase complex that ultimately leads to the reduction of molecular oxygen to water, coupled with proton translocation across the inner mitochondrial membrane. This process contributes to the electrochemical gradient used for ATP synthesis.

Research methodologies for studying this function typically involve spectrophotometric assays measuring the oxidation rate of reduced cytochrome c, as demonstrated in studies with recombinant cytochrome c oxidase subunits from other species . Experiments have shown that recombinant MT-CO2 can catalyze the oxidation of substrate cytochrome c, confirming its functional role in the electron transport chain.

What expression systems are most effective for producing recombinant Berylmys bowersi MT-CO2?

Based on successful approaches with homologous proteins, E. coli-based expression systems represent an effective platform for producing recombinant MT-CO2. Specifically, the E. coli Transetta (DE3) expression system has been successfully employed for cytochrome c oxidase subunit II from other species . The methodology involves:

• Subcloning the full-length MT-CO2 gene into an appropriate expression vector (e.g., pET-32a)

• Transforming the recombinant plasmid into a suitable E. coli strain

• Inducing protein expression using isopropyl β-d-thiogalactopyranoside (IPTG)

• Optimizing expression conditions including temperature, IPTG concentration, and induction time

When implementing this approach for Berylmys bowersi MT-CO2, researchers should consider codon optimization for E. coli expression, as mitochondrial genes often contain codons rarely used in E. coli. Additionally, inclusion of a solubility tag (such as thioredoxin or MBP) may enhance expression of soluble protein, as hydrophobic membrane proteins can be challenging to express in bacterial systems.

What purification strategies yield high-quality recombinant MT-CO2 protein?

Purification of recombinant MT-CO2 typically employs affinity chromatography approaches. For histidine-tagged recombinant MT-CO2, the following methodological workflow has demonstrated success with similar proteins:

• Affinity chromatography using Ni²⁺-NTA agarose resin

• Washing with increasing imidazole concentrations to remove non-specific binding proteins

• Elution of the target protein with high imidazole concentration buffer

• Optional tag removal using appropriate proteases if tag-free protein is required

• Secondary purification steps such as ion exchange or size exclusion chromatography

Research with similar proteins has yielded recombinant protein concentrations of approximately 50 μg/mL . The purity and identity of the recombinant protein should be verified using SDS-PAGE, Western blotting, and mass spectrometry. For MT-CO2 specifically, Western blotting has shown that the recombinant fusion protein (with tags) has an apparent molecular weight of approximately 44 kDa, which differs from the predicted mass of the native protein due to the presence of fusion tags .

How can researchers verify the functional activity of purified recombinant MT-CO2?

Verification of functional activity for recombinant MT-CO2 requires assessing its electron transfer capabilities. A methodological approach includes:

• Spectrophotometric assays measuring the oxidation of reduced cytochrome c

• UV-spectrophotometer analysis to track changes in absorbance associated with electron transfer

• Infrared spectrometer analysis to detect structural changes during catalytic activity

For comprehensive validation, researchers should compare the kinetic parameters (Km, Vmax) of the recombinant protein with those of the native protein when possible. Studies with similar proteins have demonstrated that recombinant cytochrome c oxidase subunit II can catalyze the oxidation of cytochrome c substrate, indicating preservation of functional activity . Additionally, testing the protein's response to known modulators, such as allyl isothiocyanate (AITC), can provide further confirmation of proper folding and function.

How can MT-CO2 sequence data be used for phylogenetic analysis of rodent species?

MT-CO2 sequence data provides valuable information for phylogenetic analysis of rodent species due to its evolutionary conservation and sufficient variability between species. The methodological approach involves:

• Collection of MT-CO2 sequences from multiple rodent species, including Berylmys bowersi

• Multiple sequence alignment using software such as MEGA11 or similar alignment tools

• Selection of appropriate evolutionary models based on likelihood ratio tests

• Construction of phylogenetic trees using maximum likelihood, Bayesian inference, or neighbor-joining methods

• Assessment of node support through bootstrap analysis or posterior probabilities

Researchers investigating Berylmys bowersi have utilized MT-CO2 alongside other mitochondrial genes (such as Cyt b) and nuclear genes (IRBP, RAG1, GHR) for integrative systematic analysis . This multi-gene approach provides more robust phylogenetic resolution than single-gene analysis. The comparative analysis of MT-CO2 sequences can reveal evolutionary relationships, population structure, and potential adaptive selection across rodent lineages.

What patterns of selection pressure have been observed in MT-CO2 across species?

Analysis of selection pressure on MT-CO2 across species reveals a complex evolutionary pattern. Studies of the COII gene in other organisms have shown that:

• The majority of codons in MT-CO2 typically exhibit strong purifying selection (ω << 1), reflecting functional constraints on this critical respiratory protein

• Approximately 4% of sites may evolve under relaxed selective constraint (ω = 1) in some species

• Specific sites may experience positive selection in certain lineages, potentially in response to adaptive pressures

To investigate selection patterns, researchers employ maximum likelihood models of codon substitution to estimate the ratio of nonsynonymous to synonymous substitutions (ω). Branch-site models can identify specific codons that may have experienced positive selection within particular lineages . This methodological approach is particularly valuable for understanding molecular adaptation in MT-CO2 across different rodent species, including Berylmys bowersi.

What molecular docking approaches can be used to study MT-CO2 interactions with small molecules?

Molecular docking provides insights into MT-CO2 interactions with small molecules, substrates, or inhibitors. The methodological workflow includes:

• Obtaining or generating a three-dimensional structure of MT-CO2 (via X-ray crystallography, NMR, or homology modeling)

• Preparing the protein structure (adding hydrogen atoms, assigning charges, minimizing energy)

• Generating conformers of small molecule ligands

• Performing docking simulations using software such as AutoDock, GOLD, or MOE

• Analyzing binding modes, interaction energies, and key protein-ligand contacts

This approach has been successfully applied to investigate interactions between cytochrome c oxidase subunit II and allyl isothiocyanate (AITC), revealing that a sulfur atom of AITC can form a 2.9 Å hydrogen bond with specific residues (e.g., Leu-31) . Such molecular insights guide structure-activity relationship studies and inform site-directed mutagenesis experiments targeting key binding residues.

How can site-directed mutagenesis be applied to investigate critical residues in MT-CO2?

Site-directed mutagenesis represents a powerful approach for investigating critical functional residues in MT-CO2. The methodological process includes:

• Identification of candidate residues for mutation based on:

  • Sequence conservation analysis across species

  • Structural information identifying residues in functional domains

  • Computational predictions of critical sites

  • Molecular docking results suggesting binding residues

• Design of mutagenesis primers containing the desired nucleotide changes

• Generation of mutant constructs using PCR-based mutagenesis techniques

• Expression and purification of mutant proteins

• Functional characterization comparing wild-type and mutant proteins through:

  • Enzyme activity assays

  • Binding affinity measurements

  • Structural stability assessments

This approach has been suggested for future research investigating the action sites of modulators such as AITC on cytochrome c oxidase subunit II . By systematically mutating specific residues and assessing the functional consequences, researchers can establish structure-function relationships and identify critical amino acids involved in catalysis, substrate binding, or protein-protein interactions.

What approaches can be used to study MT-CO2 expression changes during cellular differentiation?

Investigating MT-CO2 expression changes during cellular differentiation requires comprehensive molecular techniques. The methodological strategy includes:

• Cell model selection representing different stages of differentiation

• RNA extraction and quality assessment

• Quantitative analysis of MT-CO2 mRNA levels using:

  • Quantitative real-time PCR (qRT-PCR)

  • RNA-Seq for transcriptome-wide analysis

  • Northern blotting for direct visualization

• Protein-level analysis using:

  • Western blotting with specific antibodies

  • Immunocytochemistry for cellular localization

  • Proteomic approaches for global protein changes

Studies with rat T-cells have demonstrated that MT-CO2 mRNA levels are higher in cells representing early stages of T-cell development and decrease in mature T-cells . This pattern suggests differential regulation of mitochondrial gene expression during cellular differentiation. Researchers investigating similar phenomena in other cell types should include appropriate housekeeping genes or proteins as normalization controls and employ statistical methods to quantify expression changes accurately.

How can researchers address solubility issues when expressing recombinant MT-CO2?

Solubility challenges are common when expressing membrane-associated proteins like MT-CO2. A methodological troubleshooting approach includes:

• Fusion tag optimization:

  • Test multiple solubility-enhancing tags (MBP, GST, SUMO, thioredoxin)

  • Compare N-terminal versus C-terminal tag placement

  • Optimize linker length between the tag and MT-CO2

• Expression condition modifications:

  • Reduce induction temperature (e.g., 16-20°C instead of 37°C)

  • Lower IPTG concentration (0.1-0.5 mM range)

  • Extend expression time (overnight or longer at reduced temperature)

  • Add solubility enhancers to the culture medium (e.g., sorbitol, glycerol)

• Co-expression with chaperones:

  • Introduce plasmids encoding chaperone proteins (GroEL/GroES, DnaK/DnaJ)

  • Optimize chaperone induction timing relative to target protein

• Detergent screening if membrane integration is required:

  • Test multiple detergent classes (non-ionic, zwitterionic, mild ionic)

  • Optimize detergent concentration for solubilization efficiency

Successful expression of soluble cytochrome c oxidase subunit II has been achieved using the pET-32a vector system, which incorporates a thioredoxin fusion tag that enhances solubility . This approach yielded functional protein capable of catalyzing substrate oxidation, demonstrating that recombinant MT-CO2 can be expressed in a biochemically active form with appropriate optimization.

What strategies can resolve discrepancies in activity measurements of recombinant MT-CO2?

Variability in activity measurements of recombinant MT-CO2 requires systematic troubleshooting. The methodological approach includes:

• Standardization of assay conditions:

  • Precise control of temperature, pH, and ionic strength

  • Careful preparation of substrate solutions with verified concentration

  • Consistent enzyme concentration across experiments

  • Standardized data collection parameters (time points, wavelength)

• Identification of inhibitory factors:

  • Testing for inhibitory compounds in the protein preparation

  • Assessing the impact of storage conditions on activity

  • Evaluating the effect of freeze-thaw cycles

• Validation across multiple assay methods:

  • Comparing spectrophotometric, polarographic, and fluorescence-based assays

  • Correlating activity with protein structural integrity

  • Benchmarking against well-characterized reference samples

• Statistical analysis of variability:

  • Calculation of intra-assay and inter-assay coefficients of variation

  • Implementation of appropriate statistical tests for comparing conditions

  • Use of replicate measurements to enhance reliability

When measuring cytochrome c oxidation activity, researchers should be aware that recombinant MT-CO2 activity can be influenced by small molecules such as allyl isothiocyanate (AITC) . Comprehensive controls and carefully documented methodologies are essential for resolving discrepancies and ensuring reproducible activity measurements.

How might MT-CO2 research contribute to understanding mitochondrial evolution in rodents?

Research on MT-CO2 offers significant potential for understanding mitochondrial evolution in rodents. Future research directions may include:

• Comprehensive phylogenomic analysis:

  • Expanding MT-CO2 sequence datasets across diverse rodent lineages

  • Integrating with other mitochondrial and nuclear genes for robust evolutionary reconstructions

  • Investigating selection patterns across evolutionary timescales

• Structure-function relationship studies:

  • Comparative analysis of MT-CO2 amino acid changes and their impact on function

  • Investigation of coevolution between MT-CO2 and interacting proteins

  • Examination of adaptive mutations in response to environmental pressures

• Mitonuclear compatibility research:

  • Analysis of coevolution between mitochondrial-encoded MT-CO2 and nuclear-encoded cytochrome c

  • Investigation of potential incompatibilities in hybrids between divergent populations

  • Assessment of fitness consequences of mitonuclear interactions

Studies on other species have demonstrated that interpopulation divergence at the COII locus can reach nearly 20% at the nucleotide level, with numerous nonsynonymous substitutions . This substantial variation suggests that MT-CO2 may serve as a valuable marker for investigating evolutionary processes, population divergence, and adaptive selection in rodents, including Berylmys bowersi and related species.

What novel applications might emerge from structural studies of Berylmys bowersi MT-CO2?

Structural characterization of Berylmys bowersi MT-CO2 could enable several innovative research applications:

• Structure-based inhibitor design:

  • Development of species-specific modulators targeting unique structural features

  • Design of research tools for probing electron transport mechanisms

  • Potential therapeutic applications targeting homologous proteins in disease models

• Protein engineering approaches:

  • Creation of chimeric proteins to investigate domain-specific functions

  • Development of optimized recombinant versions with enhanced stability or activity

  • Engineering of biosensor applications based on conformational changes

• Comparative structural biology:

  • Analysis of species-specific structural adaptations in the electron transport chain

  • Investigation of structural basis for functional differences between species

  • Understanding of evolutionary constraints on protein structure

Molecular docking studies have already demonstrated the value of structural information in understanding interactions between cytochrome c oxidase subunit II and small molecules . Expanded structural characterization of Berylmys bowersi MT-CO2 would provide a foundation for sophisticated structure-function analyses and potential biotechnological applications.