Recombinant Beta- (1-->2)glucan export ATP-binding/permease protein NdvA

Shipped with Ice Packs
In Stock

Description

Overview of NdvA

NdvA is a 609–amino acid protein (~66.6 kDa) belonging to the ABC transporter superfamily (TC 3.A.1.108.1) . It facilitates the export of β-(1→2)-glucans, which are vital for bacterial motility, biofilm formation, and symbiotic nodulation in plants . Recombinant NdvA is synthesized using heterologous expression systems like E. coli or yeast, enabling studies on its structure and function .

Production Methods

Recombinant NdvA is produced via:

  • Expression Systems: E. coli, yeast (Pichia pastoris), and baculovirus .

  • Tags: Often fused with His-tags for purification .

  • Purity: >85–90% (verified by SDS-PAGE) .

Research Findings

  • Role in Symbiosis: ndvA mutants in Rhizobium meliloti fail to export β-glucans, leading to defective root nodule formation in alfalfa .

  • Mechanistic Insights: NdvA homologs (e.g., ChvA in Agrobacterium) share structural motifs with HlyB and Mdr, implicating a conserved ATP-driven export mechanism .

  • Biochemical Activity: ATP hydrolysis by the NBD is essential for glucan translocation across the inner membrane .

Applications

  • Agricultural Research: Studying NdvA aids in engineering bacterial strains for improved plant symbiosis .

  • Biotechnological Tools: Recombinant NdvA serves as a model for ABC transporter dynamics and membrane protein studies .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly specify them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development according to your specification.
Synonyms
ndvA; Beta-(1-->2glucan export ATP-binding/permease protein NdvA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-595
Protein Length
full length protein
Species
Bartonella bacilliformis
Target Names
ndvA
Target Protein Sequence
MSLFRTYVRVLSYLNQEKNAFLLICTANITLAIITIAEPILFGHVIDTIADKSDTLVTLA VWMCFGISNIIAYVLVARGADRLAHRCRLTVLEKSFARIISMPLIWHQQRGTSHALHTLL RATDSMSSIWLEFMRQHLSTFVALFVLVPVTFKMNWRLSIVLMVLAILYILIARLVMQKT KNGQAAVEHYHHNLFKHITDSISNVSIVQSYNRITEETSALHQHTNNLLSAQTPVLNWWA LASGLNRMASTISIVCVLLLGAFFVIKGQLSVGEVVTFVGFSQLMIGRLDQISGFINLAV SSQAKLQEFFDMEDSTFQTNEPANLPSLPNVKGAIQFHHVTYEFPNSSQGVFDISFEVKA GQTVAIVGPTGAGKTTLINLLQRVYDPTVGYISIDGININSINRESLRKALATVFQDAGL FDRTIRDNISIGKTGATDEELYEATKTASAHDFILKKSKNYDTLVGERGSQLSGGERQRL AIARAILKNAPILILDEATSALDVETEIRVKNAIDCISQNRTTFIIAHRLSTIRNADLVL FLDQGRLIEKGSFQELINKDGHFYKLLKRGGLTINQPATKEKDDNIIPLRKAMAL
Uniprot No.

Target Background

Function
This protein plays a role in beta-(1-->2)glucan export. Its transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Protein Families
ABC transporter superfamily, Beta-(1-->2)glucan exporter (TC 3.A.1.108.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NdvA in bacterial systems?

NdvA functions as an ATP-dependent exporter of cyclic beta-glucans in nitrogen-fixing bacteria such as Sinorhizobium meliloti. It is responsible for transporting synthesized cyclic beta-glucans from the cytoplasm to the periplasmic space and exterior environment. Research has demonstrated that NdvA's activity is critical for proper cellular adaptation to low osmotic conditions, as cyclic beta-glucans help bacteria maintain cellular integrity in hypoosmotic environments. Additionally, functional NdvA is essential for successful symbiotic interactions with leguminous plants, as it facilitates the export of signaling molecules that contribute to infection thread formation and nodule development .

The transport mechanism involves the utilization of ATP hydrolysis to power the movement of cyclic beta-glucans across the cellular membrane. As a member of the ATP-binding cassette (ABC) transporter family, NdvA contains characteristic domains including nucleotide-binding domains (NBDs) with conserved Walker A and Walker B motifs, which interact with ATP and coordinate with the Mg²⁺ cofactor during the transport process .

How is NdvA expression regulated in response to environmental conditions?

The transcription of the ndvA gene is primarily regulated by the FeuP/FeuQ two-component regulatory system, which functions as an osmosensory mechanism. Under low osmolarity conditions, the FeuQ sensor kinase activates the FeuP response regulator through phosphorylation, which then stimulates ndvA transcription. This regulatory pathway ensures that cyclic beta-glucan export occurs predominantly in hypoosmotic environments where these molecules are most needed for bacterial adaptation .

Experimental evidence from transcriptome analysis shows that FeuP controls the expression of at least 16 genes including ndvA. When feuP function is lost, bacteria display characteristics associated with cyclic beta-glucan export defects, including poor growth and reduced motility in hypoosmotic conditions. Importantly, while these mutants can still synthesize intracellular cyclic beta-glucans, they cannot export them to the periplasm or extracellular environment. This regulatory mechanism allows bacteria to modulate cyclic beta-glucan export in response to changing environmental conditions, which is particularly important during the establishment of symbiotic relationships with host plants .

What experimental approaches are used to analyze NdvA function in bacterial systems?

Several methodological approaches have proven effective for analyzing NdvA function:

  • Site-directed mutagenesis: Creating targeted mutations in the ndvA gene followed by phenotypic analysis has been instrumental in identifying critical domains and residues required for proper protein function. This approach has helped researchers understand how specific regions contribute to ATP binding, hydrolysis, and substrate transport .

  • Gene expression analysis: Quantitative PCR and RNA sequencing are commonly used to measure ndvA expression levels under various conditions, particularly in response to osmotic changes. Transcriptome analysis has revealed that ndvA expression is significantly upregulated in hypoosmotic environments and is dependent on the FeuP response regulator .

  • Complementation studies: Researchers often use complementation assays wherein mutant strains lacking functional ndvA are transformed with plasmids containing wild-type or modified versions of the gene. For example, studies have shown that constitutive expression of ndvA can restore cyclic beta-glucan export capability to feuP mutant cells, confirming the regulatory relationship between these two factors .

  • Biochemical analysis of cyclic beta-glucans: Extraction and chromatographic separation techniques allow researchers to quantify the levels of intracellular versus extracellular cyclic beta-glucans, providing direct evidence of NdvA's export function. These analyses typically involve isolation of bacterial cells, separate extraction of cellular and extracellular fractions, and subsequent analysis using methods such as high-performance liquid chromatography (HPLC) or mass spectrometry .

How does the molecular structure of NdvA contribute to its substrate specificity and transport mechanism?

NdvA belongs to the ATP-binding cassette (ABC) transporter family, which is characterized by specific structural features that determine its function. The protein contains transmembrane domains that form a channel through the membrane and nucleotide-binding domains (NBDs) that bind and hydrolyze ATP to power transport. The NBDs contain several conserved motifs that are critical for function: the Walker A motif, which interacts directly with ATP; the Walker B motif, which coordinates with the Mg²⁺ cofactor and is involved in ATP hydrolysis; the signature sequence (C-loop), which contacts the nucleotide in the active site; and the D-loop and Q-loop, which are involved in communication between the ATP-binding sites and the transmembrane domains .

The substrate specificity of NdvA is determined by the structure of its transmembrane domains, which form a pathway through which cyclic beta-glucans are transported. Research suggests that these domains contain specific binding sites that recognize the unique structural features of cyclic beta-glucans. During the transport cycle, ATP binding causes the NBDs to dimerize in a "sandwich" configuration, with the two ATP molecules positioned between the Walker A motif of one monomer and the signature sequence of the other. This conformational change is transmitted to the transmembrane domains, causing them to alternate between inward-facing and outward-facing orientations, which facilitates the movement of cyclic beta-glucans across the membrane .

Future structural studies using techniques such as X-ray crystallography or cryo-electron microscopy would provide valuable insights into the precise mechanisms of substrate recognition and translocation by NdvA.

What are the implications of contradictory findings in studies of NdvA and cyclic beta-glucan transport?

Research on NdvA and cyclic beta-glucan transport has sometimes yielded contradictory results, which is not uncommon in scientific research. These contradictions may arise from differences in experimental conditions, bacterial strains, or methodological approaches. For example, studies examining the phenotypic effects of ndvA mutations may show varying degrees of impact on symbiotic capabilities depending on the host plant species used or the specific environmental conditions of the experiment .

When confronted with contradictory findings, researchers should consider several factors:

To resolve contradictory findings, researchers should:

  • Conduct meta-analyses of existing studies to identify patterns and sources of variation

  • Design experiments with appropriate controls and sufficient replication

  • Use multiple complementary techniques to verify results

  • Consider publishing negative or contradictory results to contribute to a more complete understanding of the system

How does the function of NdvA in Sinorhizobium meliloti compare to similar transporters in other bacterial species?

For example, in B. japonicum, studies have identified the ndvB and ndvC genes as important for beta-glucan synthesis. A Tn5 insertion mutation in ndvC resulted in the production of altered cyclic beta-glucans composed almost entirely of beta-(1-->3)-glycosyl linkages, suggesting that ndvC is involved in introducing beta-(1-->6) linkages. This mutant showed only slight sensitivity to hypoosmotic growth conditions but was severely impaired in symbiotic interactions with soybean, indicating that the specific structure of the beta-glucan molecules is important for successful symbiosis .

In contrast, S. meliloti requires the FeuP/FeuQ two-component system for proper regulation of ndvA expression and cyclic beta-glucan export. This suggests that different bacterial species may have evolved distinct regulatory mechanisms to control the synthesis and export of these important molecules .

Understanding these similarities and differences is crucial for developing a comprehensive model of cyclic beta-glucan transport across bacterial species and for identifying potential targets for enhancing symbiotic nitrogen fixation in agricultural applications.

How can advanced genetic techniques be applied to study the role of NdvA in plant-microbe interactions?

Advanced genetic techniques offer powerful approaches for investigating NdvA's role in plant-microbe interactions:

  • CRISPR-Cas9 genome editing: This technique allows for precise modifications of the ndvA gene, enabling researchers to create specific mutations that target functional domains without disrupting the entire gene. By creating a series of mutations and analyzing their effects on protein function and symbiotic phenotypes, researchers can map the relationship between protein structure and function in vivo.

  • Fluorescent protein tagging: By creating fusion proteins between NdvA and fluorescent reporters such as GFP, researchers can visualize the subcellular localization and dynamics of NdvA during different stages of symbiotic interaction. This approach can reveal how the protein's distribution changes in response to osmotic conditions or during infection thread formation.

  • Transcriptomics and proteomics: RNA sequencing and mass spectrometry-based proteomics can provide comprehensive insights into how ndvA expression fits within the broader regulatory networks controlling symbiosis. These techniques can identify co-regulated genes and proteins, potentially revealing new components of the cyclic beta-glucan export machinery .

  • Single-cell analysis: Technologies for analyzing gene expression and protein function at the single-cell level can reveal heterogeneity within bacterial populations during symbiotic interactions. This may be particularly important for understanding how subpopulations of bacteria with different NdvA expression levels contribute to successful nodulation.

  • In situ hybridization and immunolocalization: These techniques can be used to detect ndvA transcripts and NdvA protein within nodule tissues, providing spatial information about gene expression and protein localization during symbiosis.

Key experimental findings on NdvA function and regulation

GenotypeCyclic β-glucan synthesisCyclic β-glucan exportGrowth in hypoosmotic conditionsMotilitySymbiotic phenotype with legumes
Wild-typeNormalNormalNormalNormalNormal nodulation and nitrogen fixation
ndvA mutantNormalDefectiveSlightly impairedImpairedSeverely defective nodulation
feuP mutantNormalDefectivePoorReducedUnable to invade plant tissue during early infection
feuQ mutantNormalDefectivePoorReducedDefective symbiotic infection
feuP mutant + constitutive ndvANormalRestoredImprovedImprovedRescued symbiotic phenotype

This table summarizes key experimental findings regarding the phenotypic effects of mutations affecting NdvA function and its regulation by the FeuP/FeuQ two-component system. The data demonstrate that while ndvA, feuP, and feuQ mutants all retain the ability to synthesize cyclic beta-glucans intracellularly, they are defective in exporting these compounds. This export deficiency correlates with impaired growth and motility under hypoosmotic conditions and severe defects in symbiotic interactions with legume hosts. Importantly, constitutive expression of ndvA in a feuP mutant background restores cyclic beta-glucan export and rescues the symbiotic phenotype, confirming that the primary role of FeuP in symbiosis is to regulate ndvA expression .

Structural features of NdvA and related ABC transporters

Table 2: Conserved motifs in NdvA and other ABC transporters

MotifConsensus sequenceLocationFunction in transport mechanism
Walker AGXXGXGKS/TNBDATP binding; interacts with phosphate groups of ATP
Walker BhhhhDNBDATP hydrolysis; coordinates with Mg²⁺ cofactor
Signature (C-loop)LSGGQNBDInteracts with ATP in sandwich dimer configuration
D-loopSALDNBDMediates communication between ATP-binding sites
Q-loopContains conserved glutamineNBDContacts γ-phosphate of ATP; couples NBDs to TMDs
H-loopContains conserved histidineNBDParticipates in ATP hydrolysis reaction

This table outlines the conserved motifs found in NdvA and other ABC transporters, their consensus sequences, locations within the nucleotide-binding domains (NBDs), and functions in the transport mechanism. These structural features are highly conserved across the ABC transporter family and play crucial roles in ATP binding, hydrolysis, and the coupling of these events to substrate translocation through the transmembrane domains (TMDs). Understanding these structural elements is essential for elucidating the molecular mechanism by which NdvA exports cyclic beta-glucans .

What are the optimal approaches for isolating and characterizing cyclic beta-glucans transported by NdvA?

Proper isolation and characterization of cyclic beta-glucans are critical for studying NdvA function. Researchers should consider the following methodological approaches:

  • Differential extraction protocols: To distinguish between intracellular and exported cyclic beta-glucans, separate extraction of cellular and extracellular fractions is necessary. This typically involves centrifugation to separate cells from culture supernatant, followed by specific extraction procedures for each fraction. For intracellular cyclic beta-glucans, cells are typically lysed using methods such as sonication or enzymatic digestion, followed by extraction with hot water or mild alkali. Extracellular cyclic beta-glucans can be precipitated from culture supernatants using ethanol or acetone .

  • Chromatographic separation: High-performance liquid chromatography (HPLC), particularly size-exclusion chromatography, is widely used for separating cyclic beta-glucans based on their molecular size. Ion-exchange chromatography can also be effective for separating charged derivatives .

  • Structural analysis: Nuclear magnetic resonance (NMR) spectroscopy is the gold standard for determining the detailed structure of cyclic beta-glucans, including the types of glycosidic linkages (e.g., beta-(1-->3) vs. beta-(1-->6)). Mass spectrometry provides information about molecular weight and can help identify modifications. Enzymatic digestion with specific glycosidases followed by analysis of the resulting fragments can provide additional structural information .

  • Quantification methods: Colorimetric assays, such as the anthrone method or phenol-sulfuric acid method, are commonly used for quantifying total carbohydrate content. More specific methods, such as enzyme-linked immunosorbent assays (ELISAs) using antibodies against specific cyclic beta-glucan structures, can provide greater specificity .

When designing experiments to analyze NdvA-mediated transport, researchers should carefully consider the timing of sample collection, as cyclic beta-glucan production and export are influenced by growth phase and environmental conditions, particularly osmolarity. Appropriate controls, including wild-type strains and mutants defective in specific aspects of cyclic beta-glucan synthesis or export, are essential for accurate interpretation of results.

What emerging technologies could advance our understanding of NdvA-mediated beta-glucan export?

Several emerging technologies hold promise for advancing research on NdvA-mediated beta-glucan export:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized structural biology by allowing visualization of membrane proteins in their native environment without crystallization. Applying cryo-EM to study the structure of NdvA in different conformational states could provide unprecedented insights into the transport mechanism .

  • Single-molecule techniques: Methods such as single-molecule FRET (Förster resonance energy transfer) and optical tweezers could be used to monitor conformational changes in NdvA during the transport cycle in real-time, providing dynamic information that complements static structural data.

  • In situ structural biology: Techniques that allow visualization of protein structure and function within living cells, such as in-cell NMR and super-resolution microscopy, could reveal how NdvA behaves in its native cellular context during symbiotic interactions.

  • Systems biology approaches: Integration of multi-omics data (genomics, transcriptomics, proteomics, metabolomics) using machine learning algorithms could help identify previously unknown factors that influence NdvA function and regulation, placing it within the broader context of cellular networks controlling symbiosis.

  • Synthetic biology: Engineering bacteria with modified versions of NdvA or novel regulatory circuits controlling its expression could provide new tools for studying its function and potentially enhance symbiotic nitrogen fixation for agricultural applications.

How might research on NdvA contribute to improving symbiotic nitrogen fixation in agricultural systems?

Understanding the molecular mechanisms of NdvA-mediated cyclic beta-glucan export has significant implications for improving symbiotic nitrogen fixation in agriculture:

  • Enhanced rhizobial inoculants: Knowledge of how NdvA and cyclic beta-glucans contribute to successful symbiosis could guide the development of improved rhizobial strains for use as inoculants. For example, strains engineered to optimize cyclic beta-glucan export under specific field conditions might establish more effective symbioses with legume crops.

  • Extending symbiotic range: Insights from NdvA research could contribute to efforts to extend nitrogen-fixing symbioses to non-legume crops. Understanding the molecular signals involved in establishing successful symbioses, including the role of cyclic beta-glucans, is a crucial step toward this goal.

  • Improving stress tolerance: Since cyclic beta-glucans are involved in adaptation to osmotic stress, manipulating their production and export through NdvA could potentially enhance the ability of rhizobia to establish symbioses under drought or high-salinity conditions, which are increasingly common due to climate change.

  • Developing molecular markers: Knowledge of genetic variations in ndvA and its regulatory elements could lead to the development of molecular markers for selecting rhizobial strains with superior symbiotic capabilities or breeding legume varieties that interact more effectively with specific rhizobial partners.

  • Cross-species applications: Comparative studies of NdvA and related transporters across different bacterial species could reveal evolutionary adaptations that enhance symbiotic efficiency in specific host-microbe combinations, potentially leading to novel approaches for optimizing these interactions in agricultural settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.