Recombinant Beta vulgaris Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COX2; COXII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Beta vulgaris (Sugar beet)
Target Names
COX2
Target Protein Sequence
MIVREWLFFTMAPCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVSWILVRA LWHFHYKKNPIPQRIVHGTTIEIIRTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKA IGHQWYRSYEYSDYNSSDEQSLTFDSYTIPEDDPELGQSRLLEVDNRVVVPAKTHIRIIV TSADVLHSWAVPSSGVKCDAVPGRLNQTSILVQREGVYYGQCSEICGTNHAFMPIVVEAV SRKDYGSRVSNQLIPQTGEA
Uniprot No.

Target Background

Function
Beta vulgaris Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme is crucial for oxidative phosphorylation. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work together to transfer electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the CuA center (subunit 2) and heme a (subunit 1) to the active site (subunit 1), a binuclear center (BNC) consisting of heme a3 and CuB. The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 (COX2) and its functional significance in Beta vulgaris?

Cytochrome c oxidase subunit 2 (COX2) is one of the core subunits of mitochondrial Cytochrome c oxidase (Cco), which plays a crucial role in cellular respiration. COX2 contains a dual core CuA active site that is essential for electron transfer in the respiratory chain . In Beta vulgaris, as in other plants, COX2 contributes to the plant's ability to adapt to environmental stresses, particularly oxidative stress conditions. The protein is involved in catalyzing the oxidation of substrate Cytochrome C, which is fundamental to energy production in the plant's mitochondria . While specific Beta vulgaris COX2 research is emerging, structural studies from other species indicate conservation of key functional domains among plants.

How does Beta vulgaris COX2 compare structurally to COX2 from other organisms?

Based on comparative analyses similar to those performed with other species, Beta vulgaris COX2 likely shares high sequence identity with COX2 proteins from related plant species while maintaining distinctive characteristics reflective of its evolutionary adaptations. In recombinant expression studies of similar proteins, molecular masses typically range from 25-28 kDa with pI values around 6.0-6.5 . Phylogenetic analyses of COX2 proteins reveal evolutionary relationships that can help researchers understand functional conservation across species. While insect COX2 (such as from Sitophilus zeamais) has been reported to have a molecular mass of 26.2 kDa with pI value of 6.37 , Beta vulgaris COX2 may have slightly different properties reflecting its plant origin.

What expression systems have been successfully used for recombinant COX2 production?

Bacterial expression systems, particularly E. coli, have proven effective for recombinant COX2 production. The methodology typically involves:

  • Subcloning the full-length cDNA into an expression vector (such as pET-32a)

  • Transforming the construct into an E. coli strain (such as Transetta DE3)

  • Inducing expression with IPTG

  • Purifying the recombinant protein using affinity chromatography with Ni²⁺-NTA agarose if a His-tag is incorporated

Using this approach, researchers have achieved expression of recombinant COX2 with concentrations of approximately 50 μg/mL of fusion protein . For Beta vulgaris specifically, modifications to this protocol may be necessary to account for plant-specific post-translational modifications.

What are the optimal methods for purifying recombinant Beta vulgaris COX2?

Purification of recombinant Beta vulgaris COX2 typically follows these methodological steps:

  • Expression with a fusion tag (commonly 6-His tag) to facilitate purification

  • Cell lysis under controlled conditions to preserve protein structure

  • Affinity chromatography as the primary purification step (Ni²⁺-NTA agarose for His-tagged proteins)

  • Additional purification steps including ion exchange or size exclusion chromatography for higher purity

  • Confirmation of purification using SDS-PAGE and Western blotting

When using a His-tag system, recombinant COX2 fusion proteins appear at approximately 44 kDa on Western blots due to the additional mass of the fusion tags . Purification yields may vary but concentrations of 50 μg/mL have been achieved for similar proteins . This methodology preserves the structural integrity needed for subsequent functional analyses.

How can the enzymatic activity of recombinant Beta vulgaris COX2 be effectively assessed?

Assessment of recombinant Beta vulgaris COX2 enzymatic activity should include:

  • Spectrophotometric assays measuring the oxidation of reduced cytochrome c

  • UV-spectrophotometric analysis to assess substrate binding and catalytic activity

  • Infrared spectrometer analysis to examine structural features related to activity

These assays can determine if the recombinant protein maintains its ability to catalyze the oxidation of cytochrome c substrate. Research with similar proteins has shown that recombinant COX2 can effectively catalyze substrate oxidation, indicating retention of functionality after recombinant expression . For Beta vulgaris COX2, adaptation of these protocols may be necessary to account for plant-specific kinetic parameters.

What molecular docking approaches can reveal about Beta vulgaris COX2 interactions with bioactive compounds?

Molecular docking has proven valuable for understanding interactions between COX2 and bioactive compounds. Studies have shown that:

  • Compounds like allyl isothiocyanate (AITC) can interact with COX2 at specific binding sites

  • Interactions often involve hydrogen bonding with specific amino acid residues (e.g., a sulfur atom from AITC can form a 2.9 Å hydrogen bond with Leu-31)

  • Beta vulgaris contains numerous bioactive compounds including betalains that may interact with mitochondrial proteins

These interactions may explain the reported antioxidant and anti-inflammatory effects of Beta vulgaris components . Molecular docking approaches enable identification of binding sites that could be targeted for site-directed mutagenesis to further understand structure-function relationships.

How might Beta vulgaris COX2 contribute to understanding mitochondrial function under oxidative stress?

Beta vulgaris (red beetroot) demonstrates significant antioxidant capacity, suggesting its mitochondrial components including COX2 may play a role in oxidative stress response. Research has shown that:

  • Beta vulgaris contains high levels of antioxidants that protect against oxidative damage to DNA, lipids, and proteins

  • Beetroot extracts exhibit radical scavenging ability both in vitro and in vivo

  • Antioxidant enzymes show increased activity in response to beetroot supplementation

This suggests that studying Beta vulgaris COX2 could provide insights into mitochondrial adaptations to oxidative conditions. The table below summarizes findings from studies on beetroot's effects on oxidative stress markers and enzymatic antioxidant activity:

TreatmentAntioxidant CapacityEffect on Oxidative Stress MarkersEffect on Enzymatic Antioxidant Activity
Beetroot juice (8 mL/kg/day)23.5 μmol Trolox equivalents/mLTBARS ↓, PC ↓, DNA damage ↓SOD ↑, GPX ↑, CAT ↑, GR ↑
Betalains from beetroot (5-80 mg/kg/day)Not specifiedMDA ↓SOD ↑, CAT ↑, GSH ↑
Beetroot extracts (250-500 mg/kg/day)90.1% radical inhibition (DPPH assay)MDA ↓CAT ↑, NP-SH ↑

What role might recombinant Beta vulgaris COX2 play in understanding plant disease resistance mechanisms?

The functional characterization of recombinant Beta vulgaris COX2 could contribute to understanding disease resistance mechanisms in plants. Research has shown that:

  • Sugar beet (Beta vulgaris) exhibits varying resistance responses to pathogens

  • Metabolome profiling has been used to understand defense responses of Beta vulgaris to pathogens such as Rhizoctonia solani

  • Plant respiratory components play roles in stress response and disease resistance pathways

Studying recombinant Beta vulgaris COX2 could provide insights into how mitochondrial function relates to broader plant defense mechanisms. The approach would involve expressing the recombinant protein and evaluating its function under conditions that mimic pathogen stress or in the presence of defense-related signal molecules.

How can site-directed mutagenesis of Beta vulgaris COX2 enhance understanding of its catalytic mechanism?

Site-directed mutagenesis of recombinant Beta vulgaris COX2 can identify critical residues involved in catalytic activity using the following approach:

  • Identification of conserved residues through sequence alignment with well-characterized COX2 proteins

  • Creation of point mutations at suspected catalytic sites

  • Expression of mutant proteins following the same protocol used for wild-type COX2

  • Activity assays comparing wild-type and mutant proteins

This approach has proven valuable in similar studies where researchers identified key amino acid residues involved in substrate binding and catalysis . For example, research on beetroot proteins has shown that single amino acid changes can significantly alter functional properties and host-specific interactions .

What are the major challenges in obtaining active recombinant Beta vulgaris COX2?

Several challenges exist in producing active recombinant Beta vulgaris COX2:

  • Membrane protein nature: COX2 is a membrane-integrated complex , making soluble expression challenging

  • Post-translational modifications: Plant proteins often require specific modifications absent in bacterial systems

  • Protein folding: Ensuring proper folding in the expression system

  • Maintaining activity: Preserving enzymatic function throughout purification

Researchers have addressed these challenges by:

  • Using fusion tags to enhance solubility

  • Optimizing induction conditions (IPTG concentration, temperature)

  • Employing specialized E. coli strains designed for membrane protein expression

  • Utilizing mild purification conditions to maintain structural integrity

How can researchers evaluate potential interactions between Beta vulgaris COX2 and bioactive compounds from the plant?

To evaluate interactions between Beta vulgaris COX2 and bioactive compounds:

  • Enzyme inhibition/activation assays: Measure COX2 activity in the presence of purified bioactive compounds from Beta vulgaris

  • Spectroscopic analyses: Use UV-spectrophotometry and infrared spectrometry to detect binding interactions

  • Molecular docking: Perform in silico analyses to predict binding sites and interaction energies

  • Isothermal titration calorimetry (ITC): Quantify binding affinities and thermodynamic parameters

Beta vulgaris contains numerous bioactive compounds including betalains, betanin, and various phenolics that may interact with mitochondrial enzymes . Understanding these interactions could explain some of the reported health benefits of beetroot, including its antioxidant and anti-inflammatory properties .

What genomic approaches could enhance our understanding of Beta vulgaris COX2 expression regulation?

Future research should consider:

  • Transcriptomic analysis: RNA-Seq to investigate COX2 expression under various stress conditions

  • Promoter analysis: Identification of regulatory elements controlling COX2 expression

  • CRISPR-Cas9 genome editing: Targeted modification of COX2 or its regulatory elements

  • DNA methylation studies: Analysis of epigenetic regulation of COX2 expression

These approaches would build upon existing genomic research on Beta vulgaris and provide insights into how COX2 expression is regulated during development and in response to environmental stresses.

How might structural studies of Beta vulgaris COX2 contribute to understanding its unique functional properties?

Advanced structural studies would significantly advance our understanding of Beta vulgaris COX2:

  • X-ray crystallography/Cryo-EM: Determination of high-resolution structure

  • Hydrogen-deuterium exchange mass spectrometry: Identification of flexible regions and binding interfaces

  • Site-directed spin labeling: Analysis of conformational changes during catalysis

  • Comparative modeling: Prediction of structure based on homology with known COX2 structures

These approaches would complement the molecular docking studies already performed with similar proteins and provide a foundation for structure-based design of inhibitors or activators that could modulate Beta vulgaris COX2 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.