Recombinant Beta vulgaris V-type proton ATPase 16 kDa proteolipid subunit (VMAC1)

Shipped with Ice Packs
In Stock

Description

Functional Role in V-ATPase Activity

VMAC1 forms the proton-conducting pore of the V-ATPase V₀ complex, enabling ATP-driven proton translocation across membranes . Key functional insights:

  • Mechanism: The V-ATPase couples ATP hydrolysis (V₁ sector) with proton transport (V₀ sector). VMAC1’s transmembrane helices facilitate proton movement via a rotary mechanism .

  • Biological Role: Acidifies vacuoles, lysosomes, and secretory vesicles, maintaining pH gradients critical for cellular processes like protein degradation and ion homeostasis .

  • Structural Assembly: VMAC1 integrates into the V₀ c-ring structure, which interacts with assembly factors (e.g., Vma12p, Vma21p) during biogenesis .

Expression and Purification

  • Host Systems: Primarily produced in E. coli with high yield (~1.0 mg/mL) . Alternative systems (yeast, mammalian cells) enable post-translational modifications .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) . Long-term storage at -80°C; avoid repeated freeze-thaw cycles .

Biochemical Properties

ParameterDetail
ReconstitutionSolubilize in deionized water; add glycerol (5–50%) for stability
ApplicationsSDS-PAGE analysis, structural studies, antibody production
StabilityStable for 6–12 months at -80°C

Comparative Analysis

Study FocusKey FindingReference
V₀ Assembly FactorsVma12-22p complex recruits subunits a/e/f to the c-ring, preventing premature V₁ binding
Proton Channel StructureVMAC1’s transmembrane helices form a pore lined with conserved glutamate residues

Limitations and Future Directions

  • Functional Gaps: The exact role of VMAC1 in plant-specific V-ATPase regulation remains underexplored .

  • Technical Challenges: Low stability in non-lyophilized formats limits long-term use .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize development with the specified tag.
Synonyms
VMAC1; BV-16/1; V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; Vacuolar proton pump 16 kDa proteolipid subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Beta vulgaris (Sugar beet)
Target Names
VMAC1
Target Protein Sequence
MSTVFNGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG VRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD
Uniprot No.

Target Background

Function
The 16 kDa proteolipid subunit (VMAC1) is a proton-conducting pore-forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying various intracellular compartments in eukaryotic cells.
Database Links
Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is the V-type proton ATPase 16 kDa proteolipid subunit and what is its role in Beta vulgaris?

The V-type proton ATPase 16 kDa proteolipid subunit serves as a proton-conducting pore-forming component of the V0 complex within the vacuolar H+-ATPase (V-ATPase) system. This multisubunit enzyme consists of a peripheral V1 complex that hydrolyzes ATP and a membrane-integral V0 complex responsible for proton translocation. In plants including Beta vulgaris, this protein is crucial for acidifying and maintaining pH homeostasis of intracellular compartments, particularly the vacuole .

While extensive characterization has been performed in model organisms such as humans, the Beta vulgaris ortholog shares significant structural features including transmembrane domains that form the proteolipid ring structure essential for proton conductance. The protein typically contains approximately 155-165 amino acids with several transmembrane helices and conserved glutamate residues critical for proton binding and transfer .

What expression systems are suitable for producing recombinant Beta vulgaris V-type proton ATPase proteolipid subunit?

For recombinant expression of the Beta vulgaris V-type proton ATPase proteolipid subunit, several expression systems have proven effective:

  • Agrobacterium-mediated expression: Utilizing Agrobacterium tumefaciens strain GV3101 for transient or stable expression in plant tissues. This approach allows for proper post-translational modifications and folding of the membrane protein .

  • E. coli expression systems: When using bacterial expression systems, codon optimization for E. coli is essential, along with fusion tags (such as His6 or MBP) to improve solubility and facilitate purification.

  • Yeast expression systems: Pichia pastoris and Saccharomyces cerevisiae provide eukaryotic processing machinery that can be advantageous for proper folding of complex plant membrane proteins.

For methodology, transformation protocols similar to those used for BMYV viral vectors can be adapted, where A. tumefaciens harboring the expression construct is grown overnight in LB medium supplemented with appropriate antibiotics (typically 100 μM kanamycin, 100 μM rifampicin), 10 mM MES pH 5.6, and 150 μM acetosyringone at 28°C .

What are the optimal methods for isolating and purifying recombinant V-type proton ATPase proteolipid subunit from Beta vulgaris?

Isolation and purification of the recombinant V-type proton ATPase proteolipid subunit requires specialized methodologies due to its highly hydrophobic nature and membrane localization. The following protocol has been optimized for high yield and purity:

Step-by-step isolation protocol:

  • Tissue preparation: Harvest 100g of transformed Beta vulgaris tissue and flash-freeze in liquid nitrogen.

  • Homogenization: Grind tissue in extraction buffer containing 50 mM Tris-HCl (pH 7.5), 250 mM sucrose, 1 mM EDTA, 1 mM DTT, 1 mM PMSF, and protease inhibitor cocktail.

  • Differential centrifugation: Remove cellular debris by centrifugation at 10,000g for 15 minutes, followed by ultracentrifugation of the supernatant at 100,000g for 1 hour to collect membrane fractions.

  • Solubilization: Resuspend membrane pellet in solubilization buffer containing 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10% glycerol, and 1% detergent (DDM or CHAPS has shown optimal results).

  • Affinity chromatography: If the recombinant protein contains a His-tag, use Ni-NTA resin for purification, washing with increasing imidazole concentrations (10-40 mM) and eluting with 250 mM imidazole.

  • Size-exclusion chromatography: Further purify using gel filtration to separate oligomeric states and remove aggregates.

Purity assessment can be performed using SDS-PAGE followed by western blotting with antibodies against the proteolipid subunit or the affinity tag.

How can virus-induced gene silencing (VIGS) be adapted to study V-type proton ATPase proteolipid subunit function in Beta vulgaris?

VIGS represents a powerful approach for functional studies of the V-type proton ATPase proteolipid subunit in Beta vulgaris. Based on recent advances in VIGS systems for sugar beet, the following methodology can be implemented:

  • Vector construction: Design a recombinant viral vector (similar to the BMYV-SUL approach) by inserting a 70-80 bp fragment of the Beta vulgaris V-type proton ATPase proteolipid subunit gene into the viral genome .

  • Fragment selection: Choose a unique region of the target gene to ensure specificity. Similar to the CHLI gene silencing approach, targeting a region involved in essential function will produce visible phenotypes .

  • Agrobacterium infiltration: Transform the construct into Agrobacterium tumefaciens strain GV3101 and infiltrate four-week-old sugar beet seedlings using a protocol similar to that described for BMYV:

    • Grow transformed bacteria overnight in LB medium with appropriate antibiotics

    • Centrifuge at 5000 rpm for 20 minutes

    • Resuspend in infiltration medium (10 mM MgCl₂, 10 mM MES pH 5.6, 150 μM acetosyringone)

    • Adjust to OD₆₀₀ of 0.8

    • Create small holes on the leaf surface and infiltrate using a needleless syringe

  • Phenotype assessment: Document phenotypic changes resulting from silencing, which may include altered leaf color, growth defects, or changes in stress tolerance.

  • Validation: Confirm silencing efficiency using RT-qPCR to measure transcript levels of the target gene, comparing with non-silenced controls.

What techniques are most effective for analyzing protein-protein interactions involving the V-type proton ATPase proteolipid subunit in Beta vulgaris?

Several complementary approaches can be employed to investigate protein-protein interactions of the V-type proton ATPase proteolipid subunit in Beta vulgaris:

  • Split-ubiquitin yeast two-hybrid: Particularly suitable for membrane proteins, this technique can identify direct interactors by fusing the proteolipid subunit to one half of ubiquitin and a candidate interactor to the other half.

  • Co-immunoprecipitation (Co-IP): Using epitope-tagged recombinant proteolipid subunit expressed in Beta vulgaris, followed by pull-down and mass spectrometry identification of interacting partners.

  • Bimolecular Fluorescence Complementation (BiFC): By fusing split fluorescent protein fragments to the proteolipid subunit and potential interacting partners, interactions can be visualized in vivo.

  • Cross-linking coupled with mass spectrometry: Chemical cross-linking of protein complexes followed by mass spectrometry analysis can identify proximity relationships and interaction interfaces.

  • Blue native PAGE: This technique separates intact membrane protein complexes while preserving native interactions, allowing identification of the proteolipid subunit within larger V-ATPase assemblies.

For membrane proteins like the V-type proton ATPase proteolipid subunit, detergent selection is critical. A screening approach using different detergents (DDM, digitonin, CHAPS) at various concentrations should be performed to determine optimal solubilization conditions that preserve native interactions.

How can recombinant Beta vulgaris V-type proton ATPase proteolipid subunit be used to study vacuolar acidification mechanisms?

The recombinant Beta vulgaris V-type proton ATPase proteolipid subunit can serve as a valuable tool for investigating vacuolar acidification through several experimental approaches:

  • Reconstitution in liposomes: Purified recombinant proteolipid subunit can be incorporated into artificial liposomes along with other V-ATPase components to create a minimal functional system. Proton pumping activity can be measured using pH-sensitive fluorescent dyes like ACMA or pyranine.

  • Site-directed mutagenesis: By introducing specific mutations in the recombinant protein (particularly at the conserved glutamate residue required for proton translocation), the structure-function relationship can be established. These mutants can be tested in complementation assays in yeast V-ATPase mutants.

  • Inhibitor binding studies: The recombinant protein can be used to investigate binding kinetics and mechanisms of V-ATPase inhibitors like bafilomycin or concanamycin, providing insights into drug development for agricultural applications.

  • Heterologous expression: Expressing the Beta vulgaris proteolipid subunit in V-ATPase-deficient yeast strains allows assessment of its functionality across species and identification of plant-specific features.

What are the implications of V-type proton ATPase proteolipid subunit modifications for stress tolerance in Beta vulgaris?

The V-type proton ATPase proteolipid subunit plays a crucial role in stress responses in plants including Beta vulgaris. Modifications to this protein can significantly impact several stress tolerance mechanisms:

  • Salt stress tolerance: V-ATPase activity increases under salt stress to facilitate sodium sequestration in the vacuole. Modifications that enhance proteolipid subunit stability or assembly efficiency may improve salt tolerance.

  • Drought stress adaptation: Enhanced V-ATPase activity supports osmotic adjustment during water deficit. Structure-function studies of the proteolipid subunit can reveal mechanisms for optimizing this response.

  • Heavy metal detoxification: The V-ATPase energizes transporters that sequester heavy metals in the vacuole. Engineered modifications to the proteolipid subunit that enhance pump efficiency could improve heavy metal tolerance.

  • pH homeostasis under stress: The proteolipid subunit is essential for maintaining cytosolic pH during stress exposure. Studying how modifications affect proton translocation kinetics provides insights into pH adaptation mechanisms.

Research approaches for investigating these aspects include:

  • Generating transgenic Beta vulgaris lines with modified proteolipid subunit variants

  • Phenotypic assessment under controlled stress conditions

  • Measurement of vacuolar pH and compartmentalization of stress-related metabolites

  • Transcriptomic and metabolomic profiling to identify downstream effects

How can structural analysis of the Beta vulgaris V-type proton ATPase proteolipid subunit inform protein engineering efforts?

Structural analysis of the Beta vulgaris V-type proton ATPase proteolipid subunit provides critical insights for protein engineering initiatives, particularly when comparisons are made with well-characterized homologs like the human ATP6V0C:

  • Homology modeling: Using the human V-type proton ATPase 16 kDa proteolipid subunit structure as a template, a homology model of the Beta vulgaris ortholog can be generated. Key features include:

    • Four transmembrane helices forming a bundle

    • Conserved glutamate residue in the fourth transmembrane helix essential for proton binding

    • Protein-protein interaction interfaces with other V0 subunits

  • Molecular dynamics simulations: MD simulations can reveal plant-specific structural dynamics, particularly in transmembrane regions that differ from the human ortholog.

  • Structure-guided mutagenesis targets: Based on structural analysis, specific residues can be targeted for mutagenesis to:

    • Enhance stability under extreme pH conditions

    • Modify assembly efficiency with other V-ATPase components

    • Alter proton translocation kinetics

    • Engineer regulatory sites that respond to plant-specific signals

  • Protein engineering applications: The structural data can guide the development of:

    • pH-stable variants for improved stress tolerance

    • Regulatory switches for conditional V-ATPase activity

    • Interface modifications to enhance assembly efficiency

    • Chimeric proteins combining features from different species

What are the most common challenges in expressing functional recombinant V-type proton ATPase proteolipid subunit and how can they be addressed?

Expression of functional recombinant V-type proton ATPase proteolipid subunit presents several technical challenges due to its hydrophobic nature and membrane localization. The following table outlines common issues and their solutions:

ChallengeCauseSolution
Low expression levelsToxicity to host cellsUse tightly regulated inducible promoters; optimize induction conditions (temperature, inducer concentration)
Protein aggregationImproper folding of hydrophobic domainsExpress at lower temperatures (16-20°C); add solubilizing agents (glycerol, mild detergents) to culture medium
Inclusion body formationOverexpression exceeding membrane capacityReduce expression rate; co-express chaperones (GroEL/ES, DnaK)
Poor membrane integrationInefficient targeting to membraneUse specialized expression hosts with robust membrane protein machinery (C41/C43 E. coli strains, Pichia pastoris)
Protein instabilityDegradation by host proteasesInclude protease inhibitors; use protease-deficient host strains
Non-functional proteinImproper assembly or post-translational modificationExpress in eukaryotic systems that provide appropriate processing machinery
Purification difficultiesStrong association with membrane lipidsScreen multiple detergents; use optimized solubilization protocols with stepwise detergent addition

For Beta vulgaris V-type proton ATPase proteolipid subunit specifically, Agrobacterium-mediated expression in plant systems has shown promising results, using approaches similar to those developed for viral vector expression, where bacteria harboring the construct are grown in specific media conditions (LB medium with antibiotics, MES buffer, and acetosyringone) and carefully infiltrated into plant tissues .

How can researchers validate that recombinant V-type proton ATPase proteolipid subunit maintains native conformation and activity?

Validating the native conformation and activity of recombinant V-type proton ATPase proteolipid subunit requires multiple complementary approaches:

  • Structural validation:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure composition

    • Limited proteolysis assays to assess folding and accessibility of cleavage sites

    • Intrinsic fluorescence measurements to examine tertiary structure

  • Functional assays:

    • Proton transport assays using reconstituted proteoliposomes and pH-sensitive fluorescent dyes

    • ATP hydrolysis measurements when co-assembled with other V-ATPase components

    • Inhibitor binding studies using known V-ATPase inhibitors (bafilomycin, concanamycin)

  • Assembly verification:

    • Blue native PAGE to assess incorporation into higher-order complexes

    • Co-immunoprecipitation with other V-ATPase subunits

    • Size exclusion chromatography to analyze oligomeric state

  • In vivo complementation:

    • Functional complementation of yeast V-ATPase mutants lacking the proteolipid subunit

    • Phenotypic rescue in Beta vulgaris lines with reduced endogenous expression

  • Localization studies:

    • Subcellular fractionation to confirm membrane association

    • Immunofluorescence microscopy to verify targeting to appropriate compartments

    • Protease protection assays to determine membrane topology

What considerations are important when designing constructs for heterologous expression of Beta vulgaris V-type proton ATPase proteolipid subunit?

Designing optimal expression constructs for the Beta vulgaris V-type proton ATPase proteolipid subunit requires careful consideration of several factors:

  • Codon optimization:

    • Adjust codon usage to match the expression host

    • Remove rare codons that might cause translational pausing

    • Optimize GC content to prevent secondary structure formation in mRNA

  • Fusion tags and their placement:

    • N-terminal tags: Less likely to interfere with membrane insertion but may affect signal sequence processing

    • C-terminal tags: Preferable for membrane proteins as they allow proper membrane insertion

    • Cleavable tags: Include TEV or PreScission protease sites to remove tags after purification

    • Recommended tags: His6 (purification), GFP (folding indicator and visualization), MBP (solubility enhancement)

  • Promoter selection:

    • For plant expression: 35S promoter shows strong constitutive expression similar to that used in viral vector systems

    • For bacterial expression: T7 promoter with lac operator for tight regulation

    • For yeast expression: GAL1 or AOX1 promoters for inducible expression

  • Vector backbone considerations:

    • Include appropriate origin of replication for the host system

    • Select compatible antibiotic resistance markers

    • Consider copy number (low copy plasmids often better for membrane proteins)

  • Sequence modifications:

    • Include Kozak sequence for eukaryotic expression

    • Consider adding stabilizing mutations identified from homology modeling

    • Remove potential proteolytic cleavage sites

  • Expression strategies:

    • For plant expression, Agrobacterium-mediated infiltration using infiltration medium (10 mM MgCl₂, 10 mM MES pH 5.6, 150 μM acetosyringone) adjusted to OD₆₀₀ of 0.8 has shown good results

    • For bacterial expression, auto-induction media can provide gentler induction

What emerging technologies show promise for studying the role of V-type proton ATPase proteolipid subunit in Beta vulgaris cellular processes?

Emerging technologies opening new frontiers in studying the V-type proton ATPase proteolipid subunit include:

  • Cryo-electron microscopy (Cryo-EM): Enabling visualization of the complete V-ATPase structure in near-native conditions, revealing how the Beta vulgaris proteolipid subunit interacts within the larger complex.

  • CRISPR-Cas9 genome editing: Allowing precise modification of the endogenous gene to create knock-in or knockout variants in Beta vulgaris for functional studies.

  • Single-molecule FRET: Providing insights into conformational changes during proton pumping and interactions with other subunits.

  • Optogenetics: Enabling light-controlled activation or inhibition of V-ATPase activity through modification of the proteolipid subunit with light-sensitive domains.

  • Virus-induced gene silencing (VIGS): Adapted from systems like the BMYV-SUL approach in sugar beets, VIGS offers a rapid way to study loss-of-function phenotypes without stable transformation .

  • Advanced imaging techniques: Including super-resolution microscopy and correlative light and electron microscopy (CLEM) to visualize V-ATPase distribution and dynamics in living cells.

  • Nanobody development: Generation of specific nanobodies against the Beta vulgaris proteolipid subunit for immunoprecipitation, imaging, and potentially modulating function.

How might comparative studies between Beta vulgaris and other species inform our understanding of V-type proton ATPase evolution and specialization?

Comparative studies of the V-type proton ATPase proteolipid subunit across species provide valuable evolutionary insights:

  • Sequence conservation analysis: Comparing the Beta vulgaris proteolipid subunit with homologs from diverse organisms, including the human ATP6V0C, reveals conserved functional domains versus species-specific adaptations .

  • Structural comparisons: Homology modeling based on known structures (such as the human proteolipid subunit) highlights structural elements unique to Beta vulgaris that may relate to plant-specific functions.

  • Functional complementation studies: Expressing the Beta vulgaris proteolipid subunit in yeast or mammalian cells lacking the endogenous protein can determine the degree of functional conservation across kingdoms.

  • Phylogenetic analysis: Constructing evolutionary trees of proteolipid subunits across the plant kingdom helps identify selection pressures and specialization events.

  • Expression pattern comparison: Analyzing tissue-specific and developmental expression patterns across species reveals specialized roles in different organisms.

  • Regulatory mechanism investigation: Comparing transcriptional and post-translational regulation between species illuminates how V-ATPase activity is controlled in different cellular contexts.

  • Stress response comparison: Examining how the proteolipid subunit responds to environmental stresses in different species provides insights into evolved stress adaptation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.