Recombinant Betula pendula Defender against cell death 1 (DAD1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
DAD1; DAD; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; Oligosaccharyl transferase subunit DAD1; Defender against cell death 1; DAD-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Betula pendula (European white birch) (Betula verrucosa)
Target Names
Target Protein Sequence
MARSTSKDAQALIQSLRSAYAATPSNLKIIDLYVVFAVFTALIQVVYMAIVGSFPFNAFL SGLLSCIGTAVLAVCLRIQVNKENKEFKDLAPERAFADFVLCNLVLHLVIMNFLG
Uniprot No.

Target Background

Function
As a subunit of the oligosaccharyl transferase (OST) complex, Defender against cell death 1 (DAD1) plays a crucial role in catalyzing the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This process, known as protein N-glycosylation, marks the first step in the N-glycosylation pathway. N-glycosylation occurs cotranslationally, and the OST complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are essential for maximal enzyme activity.
Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is DAD1 and what is its primary function in cellular systems?

DAD1 (Defender against apoptotic cell death) is a 12.5-kDa protein initially identified as a negative regulator of programmed cell death in mammalian cells. The protein functions as a subunit of the oligosaccharyltransferase (OST) complex, which plays a critical role in N-linked glycosylation of proteins in the endoplasmic reticulum . This essential post-translational modification process affects protein folding, stability, and cellular localization, with implications for numerous biological functions. DAD1's structure shows it is approximately 40% identical in sequence to Ost2p, the 16-kDa subunit of the yeast oligosaccharyltransferase, suggesting evolutionary conservation of this protein across diverse eukaryotic species . Research indicates that DAD1 is tightly associated with other OST complex subunits including ribophorin I, ribophorin II, and OST48, forming a functional complex necessary for proper cellular glycosylation processes .

The scientific significance of DAD1 extends beyond its enzymatic role, as loss of DAD1 function in the tsBN7 cell line induces a cell death pathway, demonstrating the essential nature of N-linked glycosylation in eukaryotes . While the search results focus primarily on mammalian DAD1, the protein likely serves similar functions in plant systems such as Betula pendula, though with species-specific adaptations that remain to be fully characterized. Understanding DAD1's role in plants could provide valuable insights into stress responses, developmental processes, and disease resistance mechanisms that rely on controlled cell death pathways.

How are recombinant proteins from Betula pendula typically expressed for research purposes?

Recombinant proteins from Betula pendula are typically expressed using bacterial expression systems, with E. coli being the predominant host organism for laboratory-scale production. For example, the major birch pollen allergen Bet v 1 is commonly produced as a recombinant protein with an N-terminal His tag in E. coli expression systems, as evidenced by commercial offerings of such proteins . The process begins with the isolation and cloning of the target gene from Betula pendula tissue, followed by insertion into an appropriate expression vector containing necessary regulatory elements and affinity tags to facilitate purification. When expressing plant proteins in bacterial systems, researchers must optimize codon usage to account for differences between plant and bacterial translational machinery, which can significantly impact expression efficiency.

The historical development of recombinant protein production from Betula species dates back to the late 1980s, when the first birch pollen allergen (Bet v 1) cDNAs were cloned into phage λgt11 vectors for expression in E. coli . This pioneering work established Bet v 1 as the first cloned plant allergen and the first allergenic pathogenesis-related (PR-10-like) protein published worldwide . Since then, various expression systems have been developed, including yeast, insect cell, and plant-based platforms, each offering distinct advantages for specific research applications. When selecting an expression system for DAD1 from Betula pendula, researchers should consider protein folding requirements, post-translational modifications, yield expectations, and the intended experimental applications.

What methods are most effective for verifying the expression and purity of recombinant DAD1?

Multiple complementary analytical approaches should be employed to verify the expression and purity of recombinant DAD1 from Betula pendula. Quantitative real-time PCR (RT-qPCR) represents an essential initial verification method to confirm successful gene expression at the transcriptional level. Using specific primers designed for the DAD1 gene and an appropriate housekeeping gene such as GAPDH for normalization, researchers can quantify relative expression levels using the 2^-ΔΔCt method . For protein-level verification, SDS-PAGE coupled with Western blotting using DAD1-specific antibodies provides visual confirmation of protein expression at the expected molecular weight (approximately 12.5 kDa based on mammalian DAD1) .

Mass spectrometry techniques, particularly liquid chromatography-tandem mass spectrometry (LC-MS/MS), offer powerful tools for protein identification and characterization. This approach can confirm the amino acid sequence of the expressed protein through peptide fragment analysis while also detecting any post-translational modifications. For purification assessment, size-exclusion chromatography can evaluate protein homogeneity and potential aggregation states, while dynamic light scattering provides insights into particle size distribution and potential oligomerization. Additional functional verification might include assessing DAD1's ability to associate with other OST complex components through co-immunoprecipitation or crosslinking experiments, similar to the approach used with dithio bis(succinimidylpropionate) that successfully demonstrated DAD1's interaction with OST48 in mammalian systems .

What expression systems provide optimal yields for Betula pendula proteins?

For proteins requiring specific post-translational modifications, particularly glycosylation, yeast expression systems (Saccharomyces cerevisiae or Pichia pastoris) offer a reasonable compromise between the simplicity of bacterial systems and the modification capabilities of higher eukaryotes. Plant-based expression systems, including transient expression in Nicotiana benthamiana or stable transformation of Arabidopsis thaliana, provide the most native-like environment for Betula proteins, though with lower yields and longer production timelines. When selecting an expression system for recombinant DAD1 from Betula pendula, researchers should consider that DAD1 functions as part of the oligosaccharyltransferase complex involved in protein glycosylation , suggesting that eukaryotic expression systems might preserve functional properties better than prokaryotic alternatives, despite potential yield trade-offs.

What purification strategies are recommended for isolating recombinant DAD1?

Affinity chromatography represents the primary purification approach for recombinant DAD1, typically facilitated by incorporating a fusion tag such as His6 or GST into the expression construct. For His-tagged recombinant proteins from Betula pendula, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins provides efficient initial purification, as demonstrated with commercially available recombinant Bet v 1 proteins . This approach allows for selective binding of the tagged protein while most bacterial contaminants flow through the column, followed by elution using imidazole or pH gradient. Given DAD1's relatively small size (approximately 12.5 kDa), size exclusion chromatography serves as an excellent secondary purification step to separate the target protein from any remaining contaminants or aggregates.

Additional purification considerations arise from DAD1's natural role as a subunit of the oligosaccharyltransferase complex . If expressed in eukaryotic systems, DAD1 may co-purify with other OST components or form aggregates due to exposed hydrophobic regions normally involved in protein-protein interactions. Ion exchange chromatography can provide further purification based on DAD1's charge properties, with the specific resin (cationic or anionic) selected based on the protein's isoelectric point. For researchers requiring exceptionally high purity, hydrophobic interaction chromatography offers a complementary separation mechanism. Throughout the purification process, it is essential to monitor protein stability using dynamic light scattering or analytical size exclusion chromatography, as membrane-associated proteins like DAD1 may have limited stability in solution without appropriate detergents or stabilizing agents.

How can CRISPR-Cas9 genome editing be applied to study DAD1 function in Betula pendula?

CRISPR-Cas9 genome editing offers powerful opportunities for functional characterization of DAD1 in Betula pendula through precise genetic modifications. The implementation begins with designing specific sgRNA sequences targeting the DAD1 gene, ideally targeting exonic regions to disrupt protein function efficiently. Researchers can utilize online design tools to identify optimal target sequences with minimal off-target effects, following established methodologies where sgRNA sequences are designed based on the genomic sequence obtained from databases such as NCBI . For DAD1 targeting, the sgRNA sequence would need to be subcloned into an appropriate vector system such as pLentiCRISPR-V2, which contains both the sgRNA scaffold and Cas9 coding sequences .

For delivery into Betula pendula cells, optimized transformation protocols using Agrobacterium-mediated transformation of callus tissue or direct delivery using biolistic approaches may be employed. Following transformation, successful editing can be verified using PCR amplification of the target region followed by sequencing or mismatch cleavage assays. RT-qPCR using DAD1-specific primers and GAPDH as an internal reference can quantify knock-down efficiency at the transcriptional level, with the relative expression calculated using the 2^-ΔΔCt method . Phenotypic analysis of successfully edited plants should focus on cellular responses to stress conditions, developmental abnormalities, and specific assays for apoptotic markers, as DAD1's primary function involves negative regulation of programmed cell death pathways .

What analytical techniques can effectively characterize the structural features of recombinant DAD1?

Multiple complementary analytical techniques should be employed to comprehensively characterize the structural features of recombinant DAD1 from Betula pendula. X-ray crystallography represents the gold standard for high-resolution structural determination, though crystallization of membrane-associated proteins like DAD1 presents significant challenges requiring screening of numerous crystallization conditions with appropriate detergents or lipid environments. Nuclear Magnetic Resonance (NMR) spectroscopy offers an alternative approach for solution-state structural analysis, particularly valuable for examining protein dynamics and ligand interactions. Circular dichroism (CD) spectroscopy provides valuable information about secondary structure content (α-helices, β-sheets) and can monitor structural changes under varying environmental conditions such as pH, temperature, or in the presence of potential binding partners.

How does DAD1 interact with the oligosaccharyltransferase complex in plant systems?

While direct evidence for DAD1's interaction with the oligosaccharyltransferase (OST) complex specifically in Betula pendula is not presented in the search results, mechanistic insights can be extrapolated from mammalian studies. In mammalian systems, DAD1 functions as a tightly associated subunit of the OST complex alongside ribophorin I, ribophorin II, and OST48 . Chemical crosslinking experiments using dithio bis(succinimidylpropionate) have demonstrated that DAD1 directly interacts with OST48, forming crosslinked heterodimers . More complex associations have also been observed, including DAD1-ribophorin II-OST48 heterotrimers and DAD1-ribophorin I-ribophorin II-OST48 heterotetramers . These interactions are likely conserved in plant systems, though with potential plant-specific adaptations in the complex architecture.

Sedimentation velocity analysis of detergent-solubilized samples represents an effective approach for studying these interactions, as demonstrated in mammalian systems where DAD1 was shown to cosediment precisely with OST activity and other complex components . For plant-specific studies, co-immunoprecipitation using antibodies against DAD1 or other predicted OST components could identify interaction partners in Betula pendula. Bimolecular fluorescence complementation (BiFC) assays in plant protoplasts offer another approach, allowing visualization of protein-protein interactions in living cells. Functional consequences of these interactions could be assessed through enzymatic assays measuring OST activity in preparations with varying levels of DAD1. The characterization of these interactions is particularly significant given that loss of DAD1 function induces programmed cell death, suggesting that its role in the OST complex is essential for cell survival .

What methodological approaches can differentiate between DAD1-regulated and other apoptotic pathways in Betula pendula?

Distinguishing DAD1-regulated apoptotic pathways from other cell death mechanisms in Betula pendula requires a multifaceted experimental approach combining genetic manipulation, biochemical analysis, and cellular imaging techniques. CRISPR-Cas9-mediated knockdown or knockout of DAD1, following methodologies established for gene targeting in other systems , provides the foundation for comparing wild-type and DAD1-deficient phenotypes. Flow cytometry analysis of cells stained with Annexin V and propidium iodide can quantify apoptotic populations, while terminal deoxynucleotidyl transferase dUTP nick end labeling (TUNEL) assays can visualize DNA fragmentation characteristic of apoptosis. These approaches should be applied to both DAD1-modified and control plants under normal conditions and various stress treatments to identify DAD1-specific responses.

Biochemical characterization should focus on key apoptotic markers, including caspase-like proteases, which can be measured using fluorogenic substrates specific to different caspase homologs. Comparative transcriptomic analysis using RNA sequencing can identify differentially expressed genes between DAD1-deficient and control plants, potentially revealing DAD1-specific cell death pathways. Protein glycosylation status should be carefully monitored, as DAD1's function in the oligosaccharyltransferase complex suggests that altered N-linked glycosylation may represent the mechanistic link between DAD1 deficiency and apoptosis induction . Lectin blotting or mass spectrometry-based glycoproteomics can characterize glycosylation changes resulting from DAD1 manipulation. These methodological approaches, employed in concert, can effectively differentiate DAD1-regulated apoptotic pathways from other cell death mechanisms, providing insights into the specific molecular events downstream of DAD1 deficiency in Betula pendula systems.

What are the optimal experimental conditions for assessing DAD1 function in N-linked glycosylation?

Assessing DAD1 function in N-linked glycosylation requires carefully designed experimental systems that can detect changes in glycosylation patterns resulting from DAD1 manipulation. Cell-free translation systems supplemented with canine pancreatic microsomes or plant-derived microsomes represent valuable tools for studying N-linked glycosylation in a controlled environment. Using such systems, researchers can express reporter proteins containing N-glycosylation sites in the presence or absence of functional DAD1, either through immunodepletion of DAD1 or addition of recombinant DAD1 protein. Glycosylation status can be monitored through mobility shifts on SDS-PAGE, with glycosylated proteins showing reduced electrophoretic mobility compared to their non-glycosylated counterparts. This approach parallels methodologies used to study OST activity in mammalian systems, where DAD1 was demonstrated to cosediment precisely with enzymatic activity .

For cellular studies, CRISPR-Cas9-mediated DAD1 knockdown combined with temperature-sensitive conditional alleles can provide temporal control over DAD1 function, similar to the temperature-sensitive BHK21-derived tsBN7 cell line where DAD1 was initially characterized . Global glycosylation changes can be assessed using lectin blotting with a panel of lectins specific for different glycan structures, while mass spectrometry-based glycoproteomics offers site-specific glycosylation analysis with high sensitivity. Pulse-chase experiments using radio-labeled sugar precursors provide kinetic information about the glycosylation process under varying DAD1 conditions. The experimental design should include appropriate controls for general ER stress responses, as disruption of N-linked glycosylation may trigger unfolded protein response pathways that could complicate interpretation of direct DAD1 effects on glycosylation.

How does the structure of DAD1 compare between mammalian and plant systems?

The structural comparison of DAD1 between mammalian and plant systems reveals both conserved features and potentially important divergences that may reflect adaptation to different cellular environments. In mammalian systems, DAD1 is a relatively small protein of 12.5 kDa that functions as a tightly associated subunit of the oligosaccharyltransferase complex . While the search results do not provide specific structural data for plant DAD1, comparative sequence analysis would likely reveal conserved domains essential for its integration into the OST complex, given the fundamental importance of N-linked glycosylation across eukaryotic organisms. Hydrophobicity analysis would be expected to show membrane-spanning regions consistent with DAD1's localization to the endoplasmic reticulum membrane, where N-linked glycosylation occurs co-translationally.

Structural similarities between plant and mammalian DAD1 would likely include regions involved in protein-protein interactions, particularly those mediating association with other OST subunits such as OST48, ribophorin I, and ribophorin II . These interaction interfaces are likely evolutionarily conserved to maintain the functional architecture of the OST complex. Divergent regions might reflect adaptation to plant-specific aspects of the secretory pathway or species-specific regulatory mechanisms. Modeling approaches using the mammalian DAD1 structure as a template could predict the tertiary structure of Betula pendula DAD1, highlighting both conserved structural elements and plant-specific features. Such comparative structural analysis provides insights into functional conservation across evolutionary distance while potentially identifying unique aspects of DAD1 function in plant systems compared to mammalian counterparts.

What protein-protein interaction networks involve DAD1 in Betula species?

The protein-protein interaction network surrounding DAD1 in Betula species likely centers on its role within the oligosaccharyltransferase complex while potentially extending to regulatory interactions specific to plant systems. Based on mammalian studies, primary interaction partners would include homologs of OST48, ribophorin I, and ribophorin II, which together with DAD1 form the core OST complex . Crosslinking experiments in mammalian systems have demonstrated direct interactions between DAD1 and OST48, as well as higher-order complexes including ribophorins , suggesting these associations would likely be conserved in plant systems including Betula. Beyond the core OST complex, DAD1 may interact with components of the translocation machinery at the endoplasmic reticulum membrane, facilitating co-translational glycosylation of nascent polypeptides.

Plant-specific interactions might involve connections to stress response pathways, given DAD1's role in preventing apoptotic cell death and the importance of controlled cell death in plant development and stress responses. Such interactions could potentially include plant-specific regulatory proteins that modulate DAD1 function or stability under different environmental conditions. Methodological approaches for mapping these interactions would include yeast two-hybrid screening using DAD1 as bait, co-immunoprecipitation followed by mass spectrometry to identify interaction partners, or proximity labeling approaches such as BioID. Comparative analysis with interaction networks in model plant species like Arabidopsis could provide insights into conserved and Betula-specific aspects of DAD1's interaction landscape, potentially revealing unique regulatory mechanisms in tree species versus herbaceous plants.

What experimental approaches best demonstrate DAD1's role in preventing programmed cell death?

A comprehensive experimental strategy to demonstrate DAD1's role in preventing programmed cell death in Betula pendula would combine genetic manipulation, cellular imaging, and biochemical approaches. CRISPR-Cas9-mediated gene editing provides a powerful tool for generating DAD1 knockout or knockdown lines , allowing direct observation of cellular consequences when DAD1 function is compromised. Temperature-sensitive conditional alleles, analogous to the tsBN7 cell line where DAD1 was initially characterized , offer temporal control over DAD1 function, enabling precise timing of DAD1 inactivation and subsequent monitoring of cell death progression. Live-cell imaging using fluorescent reporters for apoptotic markers (membrane phosphatidylserine externalization, caspase activation, mitochondrial membrane potential) can visualize the cellular events following DAD1 disruption in real-time.

Biochemical characterization should include assessment of caspase-like protease activation, DNA fragmentation analysis, and examination of N-linked glycosylation status to establish the mechanistic connection between glycosylation defects and cell death initiation. Comparative transcriptomics and proteomics between wild-type and DAD1-deficient samples can identify the molecular pathways activated during DAD1-dependent cell death. Rescue experiments using wild-type DAD1 or domain-specific mutants can define the structural requirements for DAD1's anti-apoptotic function. Environmental stress experiments (heat, cold, drought, pathogen exposure) conducted on wild-type versus DAD1-modified plants can determine how DAD1 contributes to stress resilience through regulation of programmed cell death pathways. Together, these approaches would provide comprehensive insights into DAD1's role in preventing programmed cell death while potentially revealing plant-specific aspects of this function in Betula pendula.

What are the most common challenges when working with recombinant DAD1 and how can they be addressed?

Producing functional recombinant DAD1 from Betula pendula presents several technical challenges that require specific methodological solutions. The primary difficulty stems from DAD1's natural role as a membrane-associated protein within the oligosaccharyltransferase complex , making it potentially difficult to express in soluble, correctly folded form. Expression systems selection represents a critical decision point, with E. coli offering simplicity and high yields but lacking appropriate machinery for membrane protein folding and post-translational modifications. When using bacterial expression systems, fusion partners such as MBP (maltose-binding protein) or SUMO can enhance solubility, while specialized E. coli strains designed for membrane protein expression provide improved folding environments. Alternatively, eukaryotic expression systems including yeast, insect cells, or plant-based systems may better maintain native protein conformation despite potentially lower yields.

Purification challenges include the need for appropriate detergents to maintain protein stability once removed from membrane environments. A detergent screening approach is recommended, testing a range of options from harsh ionic detergents (SDS) to milder non-ionic alternatives (DDM, CHAPS) for their ability to maintain DAD1 in solution without denaturing its structure. Protein instability during storage represents another common challenge, potentially addressed through addition of glycerol (typically 10-20%), reducing agents to prevent oxidation of cysteine residues, and protease inhibitors to prevent degradation. For functional studies, reconstitution into liposomes or nanodiscs can provide a membrane-like environment that better maintains native protein conformation and activity. Throughout the expression and purification process, small-scale pilot experiments with multiple conditions are recommended before scaling up, allowing efficient optimization of protocols for this challenging protein target.

How can researchers effectively verify DAD1 knockdown or knockout in transgenic Betula pendula lines?

Comprehensive verification of DAD1 knockdown or knockout in transgenic Betula pendula requires a multi-level assessment approach targeting DNA, RNA, and protein. At the genomic level, PCR amplification of the targeted DAD1 locus followed by Sanger sequencing provides direct evidence of CRISPR-Cas9-induced mutations . For complex or heterozygous edits, next-generation sequencing offers higher sensitivity for detecting mosaic editing outcomes. The T7E1 or Surveyor nuclease assays provide rapid screening for indel mutations, where mismatches between wild-type and mutated sequences are specifically cleaved, generating diagnostic fragment patterns on gel electrophoresis. These genomic analyses should target multiple independent transgenic lines to confirm consistent editing outcomes.

Transcriptional verification using quantitative RT-qPCR with DAD1-specific primers normalized to a stable reference gene such as GAPDH quantifies the degree of knockdown achieved . The 2^-ΔΔCt method enables relative quantification of DAD1 transcript levels compared to wild-type controls. At the protein level, Western blotting using antibodies specific to Betula DAD1 provides visual confirmation of protein reduction or absence. Where species-specific antibodies are unavailable, antibodies against conserved DAD1 epitopes from related species may cross-react sufficiently. Functional verification represents the ultimate confirmation, potentially including assessment of N-linked glycosylation status through lectin blotting or mass spectrometry-based glycoproteomics, as DAD1's role in the oligosaccharyltransferase complex directly impacts this process . Phenotypic analysis for enhanced susceptibility to apoptosis triggers would provide additional functional confirmation, as DAD1 was initially identified as a negative regulator of programmed cell death .

What reference data and controls are essential for DAD1 research in Betula pendula?

Rigorous DAD1 research in Betula pendula requires comprehensive reference data and carefully selected controls to ensure experimental validity and reproducibility. Essential reference information includes the complete genomic and cDNA sequences of the Betula pendula DAD1 gene, including promoter regions, intron-exon boundaries, and untranslated regions, preferably obtained through direct sequencing rather than computational prediction. Expression patterns of DAD1 across different tissues, developmental stages, and stress conditions establish baseline data for contextualizing experimental findings. This tissue-specific expression profile could be derived from publicly available RNA-seq datasets or generated through quantitative RT-PCR analysis of multiple tissue types. Sequence comparison with DAD1 homologs from well-characterized model species (Arabidopsis, rice) and related tree species provides evolutionary context for functional studies.

Experimental controls must include appropriate negative controls (empty vector transformants for overexpression studies, non-targeting sgRNA for CRISPR experiments) and positive controls (known apoptosis inducers for cell death assays, established glycoprotein markers for glycosylation studies). Wild-type Betula pendula of the same genetic background used for transformation serves as the primary reference point for phenotypic comparisons. For RNA interference or CRISPR studies, the inclusion of transgenic lines targeting non-essential genes helps distinguish general effects of genetic manipulation from DAD1-specific phenotypes. Time-course experiments should include multiple timepoints to capture the dynamics of cellular responses, particularly important when studying stress-induced phenotypes. When analyzing protein-protein interactions, appropriate controls for non-specific binding (typically using unrelated proteins of similar size/charge characteristics) are essential for distinguishing genuine interaction partners from experimental artifacts.

How might DAD1 function in stress responses and climate adaptation in Betula pendula?

DAD1's role as a negative regulator of programmed cell death positions it as a potentially critical factor in Betula pendula's response to environmental stresses and climate adaptation mechanisms. Under various stress conditions including drought, extreme temperatures, or pathogen exposure, plant cells must precisely regulate programmed cell death pathways to either contain damage (through localized cell death) or preserve essential tissues (by preventing excessive cell death). DAD1 likely functions as a molecular "brake" on apoptotic pathways, with its activity potentially modulated under stress conditions to fine-tune cell death responses. Temperature stress is particularly relevant for birch trees in northern climates, where extreme cold events and increasingly variable temperatures due to climate change present significant physiological challenges. DAD1's involvement in the oligosaccharyltransferase complex suggests that proper protein glycosylation, which affects protein stability and function, may be critical for maintaining cellular homeostasis during temperature fluctuations.

Research methodologies to explore these connections would include comparing DAD1 expression levels across Betula pendula populations from different climatic regions, potentially revealing adaptive variations in expression patterns or protein sequence. Controlled stress experiments with wild-type and DAD1-modified plants could assess differences in survival, growth parameters, and cellular damage markers under various stress scenarios. The relationship between DAD1 function and specific stress response pathways could be investigated through transcriptomic analysis of stress-responsive genes in plants with altered DAD1 expression. Glycoproteomic approaches could identify stress-related proteins whose glycosylation is particularly dependent on DAD1 function, potentially revealing the mechanistic link between DAD1, protein glycosylation, and stress resilience. Understanding these connections has significant implications for predicting and potentially enhancing Betula pendula's adaptation to changing climate conditions.

What methodological approaches can assess the evolutionary conservation of DAD1 function across plant species?

Comprehensive assessment of DAD1's evolutionary conservation across plant species requires integrated bioinformatic and experimental approaches. Phylogenetic analysis represents the foundation, comparing DAD1 sequences from diverse plant lineages including bryophytes, gymnosperms, monocots, and eudicots to construct evolutionary trees revealing the degree of sequence conservation and identifying conserved domains versus variable regions. Selection pressure analysis using nonsynonymous to synonymous substitution ratios (dN/dS) can identify regions under purifying selection (suggesting functional constraint) versus diversifying selection (potentially indicating species-specific adaptations). These computational approaches should be complemented by structural predictions comparing the three-dimensional architecture of DAD1 across species, highlighting structurally conserved regions likely critical for function.

Experimental validation through cross-species complementation studies offers powerful evidence for functional conservation. DAD1 knockout/knockdown lines in Betula pendula could be complemented with DAD1 orthologs from diverse plant species, assessing whether these foreign genes rescue the mutant phenotype. Reciprocal experiments introducing Betula DAD1 into model systems with DAD1 mutations (Arabidopsis, tobacco) would similarly test functional interchangeability. Biochemical characterization comparing the glycosylation activity of OST complexes containing DAD1 from different species could reveal quantitative differences in enzymatic properties despite qualitative functional conservation. Yeast two-hybrid or co-immunoprecipitation studies comparing protein interaction profiles of DAD1 orthologs would identify conserved versus species-specific interaction partners. These complementary approaches would provide a comprehensive picture of DAD1's evolutionary trajectory, distinguishing core conserved functions from lineage-specific adaptations across the plant kingdom.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.