Recombinant Beutenbergia cavernae NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Role in Complex I

Complex I (NADH:quinone oxidoreductase) is a multi-subunit enzyme comprising hydrophilic and membrane-bound domains. In Beutenbergia cavernae, nuoK is part of the hydrophilic arm, where it likely interacts with other subunits (e.g., NuoG, NuoCDEFG) to facilitate electron transfer and proton translocation . Key insights include:

  • Electron Transfer Pathway: Complex I’s electron pathway involves FMN and iron-sulfur (Fe/S) clusters, with nuoK potentially contributing to structural stability or redox activity .

  • Subunit Specificity: Studies on E. coli and Thermus thermophilus complex I suggest subunits like NuoG and NuoI host Fe/S clusters (e.g., N4, N5), but nuoK’s precise role in Beutenbergia remains under investigation .

Research Applications and Suppliers

Experimental Uses

  • Structural Studies: His-tagged versions enable affinity purification for crystallization or NMR studies .

  • Enzyme Assays: Partial constructs may be used to study subunit interactions or quinone binding .

  • Immunoassays: ELISA kits facilitate quantification of nuoK in complex I preparations .

Challenges and Considerations

  1. Construct Variability: Full-length vs. partial proteins may exhibit differences in stability or activity .

  2. Storage Sensitivity: Lyophilized forms require careful reconstitution to avoid aggregation .

  3. Cross-Species Relevance: Functional studies on Beutenbergia nuoK may differ from well-characterized systems (e.g., E. coli) .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, we are happy to accommodate special requests. Please indicate your desired format in the order notes and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us and we will prioritize its development.
Synonyms
nuoK; Bcav_3219; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432)
Target Names
nuoK
Target Protein Sequence
MTLVNYLVLSGLLFTIGAATVLVRRNAIIMFMGVELMLNASNLAFVAFGRLHGTLTGEVV AFFVMVVAAAEVVVGLAIIVSIYRARRSVSVDELSLLKN
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. The immediate electron acceptor for this enzyme is believed to be a menaquinone. This process couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thus conserving redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Beutenbergia cavernae and what makes it of scientific interest?

Beutenbergia cavernae is a Gram-positive, non-spore-forming and non-motile bacterial species belonging to the family Beutenbergiaceae within the order Micrococcales. It was first isolated from soil in the Reed Flute Cave in Guilin, China . This bacterium is of phylogenetic interest due to its isolated location in the actinobacterial suborder Micrococcineae . The type strain is HKI 0122T (= DSM 12333T = ATCC BAA-8) . B. cavernae exhibits a rod-coccus growth cycle and grows best under aerobic conditions . It has a cell wall peptidoglycan that contains lysine in position 3 of the peptide subunit and an interpeptide bridge of L-Lys←L-Glu . The bacterium's genome is 4,669,183 bp long with 4225 protein-coding genes and 53 RNA genes .

How does nuoK interact with other subunits in the NADH-quinone oxidoreductase complex?

While specific interaction studies for B. cavernae nuoK are not extensively documented in the provided sources, research on homologous systems suggests that nuoK likely interacts with other membrane-embedded subunits of the NADH-quinone oxidoreductase complex. In related systems, such as the Na⁺-translocating NADH:quinone oxidoreductase of Vibrio cholerae, the enzyme consists of six subunits that work together to couple NADH oxidation to sodium ion pumping across the membrane .

The hydrophobic nature of nuoK (as evident from its amino acid sequence) suggests it is integral to the membrane domain of the complex, potentially participating in quinone binding or forming part of the ion translocation pathway. Structural biology approaches combined with site-directed mutagenesis would be necessary to fully elucidate these interactions.

What distinguishes nuoK from other NADH-quinone oxidoreductase subunits?

The nuoK subunit is one of the smaller components of NADH-quinone oxidoreductase complexes and is characterized by its highly hydrophobic nature. Unlike larger subunits that contain cofactors such as flavins or iron-sulfur clusters, nuoK likely functions primarily in structural roles or in forming part of the quinone binding site or ion translocation pathway.

Studies on related systems suggest that quinone binding involves several key residues that create a hydrophobic pocket. For instance, research on ubiquinone binding sites in alternative NADH-quinone oxidoreductases has identified specific regions involved in quinone interaction . Comparative analysis reveals that these enzymes share mechanistic similarities with azoreductases, suggesting they belong to the same FMN-dependent superfamily of enzymes .

How can researchers investigate the quinone binding properties of nuoK?

Investigating quinone binding to nuoK can be approached through multiple experimental strategies:

  • Photoaffinity labeling: Synthesize photoreactive biotinylated ubiquinone (UQ) mimics that can be cross-linked to the protein upon UV irradiation. This approach has been successfully used to identify UQ binding sites in related enzymes .

  • Site-directed mutagenesis: Based on sequence alignment with other NADH-quinone oxidoreductases, identify conserved residues potentially involved in quinone binding and mutate them to assess functional consequences.

  • Redox titration monitored by UV-visible spectroscopy: This technique can reveal the presence and properties of redox centers within the protein complex, as demonstrated in studies of Na⁺-NQR from Vibrio cholerae .

  • Liposome reconstitution assays: Reconstituting purified nuoK or the entire complex into liposomes allows assessment of quinone reduction activity and potential ion translocation function .

What are the optimal conditions for expressing recombinant Beutenbergia cavernae nuoK?

Based on available data for recombinant nuoK production:

  • Expression system: Escherichia coli is the recommended host for expression .

  • Affinity tag: An N-terminal His-tag can be fused to the protein to facilitate purification .

  • Expression vector: A suitable vector with an inducible promoter (such as T7 or BAD promoter systems) should be used, similar to the approach taken for Na⁺-NQR expression .

  • Expression conditions: While specific conditions for B. cavernae nuoK are not detailed, membrane proteins typically benefit from lower induction temperatures (16-25°C) to facilitate proper folding and membrane insertion.

  • Solubilization: As a membrane protein, detergents will be required for solubilization. Choice of detergent is critical—dodecyl maltoside (DM) has been shown to preserve quinone content in related proteins, while LDAO may remove bound quinones .

What methods can be used to assess the enzymatic activity of nuoK?

Several approaches can be employed to measure nuoK activity within the NADH-quinone oxidoreductase complex:

  • NADH oxidation assay: Monitor the decrease in absorbance at 340 nm due to NADH oxidation in the presence of appropriate quinone acceptors.

  • Quinone reduction assay: Measure the reduction of quinones spectrophotometrically.

  • Oxygen consumption measurements: Using a Clark-type oxygen electrode to monitor oxygen consumption rates in coupled reactions.

  • Ion translocation assays: If nuoK participates in ion translocation, measure ion gradients using ion-selective electrodes or fluorescent probes after reconstitution into liposomes .

  • Electron transfer inhibition studies: Using specific inhibitors to elucidate the electron transfer pathway involving nuoK.

What are the recommended storage and handling conditions for purified nuoK?

For optimal stability and activity, the following storage conditions are recommended:

  • Long-term storage: Store at -20°C/-80°C after aliquoting to avoid repeated freeze-thaw cycles .

  • Buffer composition: Tris/PBS-based buffer containing 6% Trehalose, pH 8.0 .

  • Glycerol addition: Addition of 5-50% glycerol (final concentration) improves stability for long-term storage at -20°C/-80°C .

  • Reconstitution: Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Working aliquots: Store at 4°C for up to one week .

How can researchers verify the structural integrity and proper folding of recombinant nuoK?

Several techniques can be employed to assess the structural integrity of recombinant nuoK:

  • SDS-PAGE analysis: To confirm the molecular weight and purity of the preparation .

  • Circular dichroism (CD) spectroscopy: To assess secondary structure content and proper folding.

  • Limited proteolysis: To evaluate the compactness and domain organization of the protein.

  • Native gel electrophoresis: To assess oligomeric state and complex formation.

  • Activity assays: Function is the ultimate indicator of proper folding; activity measurements as described in section 3.2 will provide evidence of structural integrity.

How can researchers investigate potential azoreductase activity in nuoK given the relationship between NADH-quinone oxidoreductases and azoreductases?

Recent research suggests that NADH-quinone oxidoreductases and azoreductases belong to the same FMN-dependent enzyme superfamily . To investigate potential azoreductase activity in nuoK:

  • Substrate screening: Test purified nuoK or the intact complex against various azo compounds to detect reduction activity.

  • Kinetic comparisons: Compare kinetic parameters for quinone and azo compound reduction to determine substrate preferences.

  • Structural modeling: Use homology modeling based on known azoreductase structures to identify potential azo compound binding sites.

  • Inhibition studies: Investigate whether known azoreductase inhibitors affect nuoK activity and vice versa.

  • Mutagenesis: Target residues predicted to be involved in substrate binding to determine their role in both quinone and potential azo compound reduction.

What insights can be gained from studying nuoK in the context of the complete Beutenbergia cavernae genome?

The complete genome sequence of B. cavernae (4,669,183 bp) encodes 4225 protein-coding genes , providing context for nuoK function:

  • Metabolic reconstruction: Analysis of the genome can reveal other components of the respiratory chain and energy metabolism, placing nuoK in its proper metabolic context.

  • Evolutionary insights: Genomic context can provide clues about the evolution of nuoK and related proteins in B. cavernae and other actinobacteria.

  • Regulatory elements: Identification of regulatory sequences upstream of the nuoK gene can provide insights into its expression patterns.

  • Operon structure: Determining whether nuoK is part of an operon with other NADH-quinone oxidoreductase subunits, as is common in bacterial respiratory complexes .

  • Functional partners: Genomic context can suggest potential interaction partners beyond the immediate complex components.

What strategies can address poor expression of recombinant nuoK in heterologous systems?

Membrane proteins like nuoK often present expression challenges:

  • Codon optimization: Adapt the codon usage to the expression host to improve translation efficiency.

  • Expression hosts: Test different E. coli strains specially designed for membrane protein expression (e.g., C41/C43, Lemo21).

  • Fusion partners: Add solubility-enhancing fusion tags such as MBP or SUMO.

  • Growth conditions: Lower induction temperature (16-20°C) and inducer concentration.

  • Media optimization: Use specialized media formulations like Terrific Broth or auto-induction media.

  • Toxic effects management: Use tightly controlled inducible promoters to minimize toxicity from membrane protein overexpression.

How can researchers overcome challenges in purifying functional nuoK?

Purification of membrane proteins presents unique challenges:

  • Detergent screening: Test multiple detergents (DDM, LMNG, CHAPS, etc.) for optimal solubilization without compromising function. Evidence suggests that dodecyl maltoside may better preserve quinone content than LDAO .

  • Two-step purification: Combine affinity chromatography (utilizing the His-tag) with size exclusion or ion exchange chromatography for higher purity.

  • Buffer optimization: Screen various buffer compositions, pH values, and salt concentrations to maintain stability during purification.

  • Lipid addition: Consider adding phospholipids during purification to stabilize the protein.

  • Rapid processing: Minimize time spent in detergent solution and process at 4°C to reduce denaturation.

  • Activity assays: Monitor activity throughout purification to ensure functionality is preserved.

What considerations are important when designing experiments to investigate ion translocation by NADH-quinone oxidoreductase complexes?

When studying potential ion translocation function:

  • Reconstitution system: Carefully choose lipid composition for liposome reconstitution that supports protein function.

  • Ion gradients measurement: Select appropriate ion-selective electrodes or fluorescent probes (e.g., ACMA for proton gradients, sodium-sensitive dyes for Na⁺ gradients).

  • Control experiments: Include proper controls such as ionophores (e.g., CCCP for protons, monensin for Na⁺) to collapse gradients.

  • Multiple techniques: Combine techniques such as membrane potential measurements with direct ion flux assays.

  • Time-resolved measurements: Consider the kinetics of ion translocation in experimental design.

  • Inhibitor studies: Use specific inhibitors to distinguish between different ion translocation mechanisms.

What emerging technologies might advance research on nuoK and related proteins?

Several cutting-edge approaches show promise for nuoK research:

  • Cryo-electron microscopy: For high-resolution structural determination of membrane protein complexes without crystallization.

  • Nanodiscs technology: For studying membrane proteins in a more native-like lipid environment.

  • Single-molecule techniques: To investigate dynamic aspects of protein function that are masked in ensemble measurements.

  • Native mass spectrometry: For analyzing intact membrane protein complexes and their interactions.

  • CRISPR-Cas9 genome editing: For generating knockouts or introducing specific mutations in B. cavernae to study nuoK function in vivo.

  • Computational approaches: Advanced molecular dynamics simulations and machine learning methods to predict structure-function relationships.

What are the potential biotechnological applications of research on NADH-quinone oxidoreductases like nuoK?

Understanding and manipulating NADH-quinone oxidoreductases could lead to various applications:

  • Bioremediation: Engineering bacteria with enhanced azoreductase activity (related to NADH-quinone oxidoreductases ) for degradation of azo dyes in industrial wastewater.

  • Bioenergy: Manipulating electron transport chains for improved biofuel production or microbial fuel cells.

  • Biosensors: Developing sensors for quinones or related compounds based on purified enzymes.

  • Antimicrobial targets: As critical components of bacterial energy metabolism, these enzymes represent potential targets for novel antibiotics.

  • Bioelectronics: Utilizing electron transfer properties for development of bioelectronic devices.

How might understanding nuoK contribute to broader knowledge of bacterial adaptation to extreme environments?

As B. cavernae was isolated from a cave environment , studying nuoK may provide insights into:

  • Energy conservation strategies: How bacteria optimize energy metabolism in nutrient-limited environments.

  • Redox homeostasis: Mechanisms for maintaining redox balance under challenging conditions.

  • Evolutionary adaptations: How respiratory complexes have evolved for function in specific niches.

  • Cross-species comparisons: Comparative analysis with NADH-quinone oxidoreductases from bacteria in different extreme environments could reveal adaptive patterns.

  • Stress responses: Potential roles in adapting to oxidative stress or other environmental challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.