Recombinant Bifidobacterium adolescentis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will then prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to concentrate the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a specified tag type preference, please inform us, and we will prioritize developing the protein with your desired tag.
Synonyms
lspA; BAD_1132; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Target Names
lspA
Target Protein Sequence
MKNDQRRLRDRVAVFACIAIAAIAIDQLTKMWALSALADGRTIRVIPGLLSLTLVRNPGA SLGMGSGMTWLISLLAMAACVALVVLAVRTISMKWTVLFAFAFAGAFGNLIDRVIYAEGF LNGKVVDFLNYGWSIGNVADIFLMLAGVAAVLLLFLGEPFSQKDLDEANGKTLGDDANAT DDGAKAA
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (LspA) and what role does it play in B. adolescentis?

Lipoprotein signal peptidase (LspA) is a membrane-bound enzyme that catalyzes the second step in the bacterial lipoprotein (BLP) processing pathway. In Bifidobacterium adolescentis, as in other bacteria, LspA functions as an aspartyl protease that cleaves the signal peptide to the N-terminal side of the lipidated cysteine in prolipoprotein (pBLP) substrates. This cleavage generates a diacylated bacterial lipoprotein (DA-BLP) that is anchored to the membrane by two fatty acyl chains, and releases the free signal peptide as a second product of the reaction . B. adolescentis is a beneficial microbe found in high abundance (10⁹-10¹⁰ cells/g) in the large intestine of 60-80% of healthy human adults . The proper processing of lipoproteins by LspA is likely essential for B. adolescentis to maintain cellular functions and interact with the host.

How does the canonical lipoprotein processing pathway function in bacteria?

The canonical bacterial lipoprotein processing pathway consists of three sequential enzymatic steps:

  • Lgt (Lipoprotein diacylglyceryl transferase): Catalyzes the first lipid modification by transferring a diacylglyceryl moiety from phosphatidylglycerol (PG) to the thiol group of the invariant cysteine in the lipobox of preprolipoprotein (ppBLP), generating prolipoprotein (pBLP) .

  • LspA (Lipoprotein signal peptidase): Cleaves the signal peptide from pBLP to produce diacylated bacterial lipoprotein (DA-BLP) .

  • Lnt (Apolipoprotein N-acyltransferase): Transfers an acyl chain, preferentially from phosphatidylethanolamine (PE), to the N-terminal amine group of the lipidated cysteine, creating triacylated bacterial lipoprotein (TA-BLP) .

This pathway is critical for proper lipoprotein localization and function, with variations existing between Gram-negative and Gram-positive bacteria. In some Gram-positive bacteria like Firmicutes, alternative acyltransferases such as LnsAB may replace Lnt .

What conserved structural features characterize LspA enzymes?

LspA enzymes across bacterial species share several key structural features:

  • Membrane topology: Four transmembrane helices (TMHs) with N- and C-termini located in the cytoplasm .

  • Extracytoplasmic domain: Composed of a β-cradle and a loop with a single-turn helix, which interact with the tether and possibly the U-domain of pBLP substrates .

  • Catalytic dyad: Two strictly conserved aspartate residues that cluster at the extracytoplasmic end of the TMH bundle and are essential for catalytic activity .

  • Positive inside rule: The cytoplasmic end of the TMH bundle is predominantly cationic .

Analysis of X-ray crystal structures from P. aeruginosa (169 amino acids) and S. aureus (163 amino acids) has revealed these conserved features, which are likely present in B. adolescentis LspA as well .

What expression systems are most effective for producing recombinant B. adolescentis LspA?

For successful expression of recombinant B. adolescentis LspA, researchers should consider the following expression systems:

  • E. coli-based membrane protein expression systems: Modified E. coli strains such as C41(DE3) or C43(DE3) are specifically designed for membrane protein expression. These strains have mutations that prevent the toxic effects of membrane protein overexpression .

  • Controlled expression vectors: Using vectors with tightly regulated promoters (e.g., pET series with T7lac promoter) allows careful induction and expression control.

  • Fusion tags: Addition of fusion partners like maltose-binding protein (MBP) or thioredoxin can enhance solubility, while His6-tags facilitate purification.

For optimal expression, consider these parameters:

  • Lower induction temperatures (16-25°C)

  • Reduced IPTG concentrations (0.1-0.5 mM)

  • Extended expression times (16-24 hours)

  • Rich media supplemented with glycerol and specific ions

Bifidobacterial genes often have a high GC content and different codon usage preferences compared to E. coli, so codon optimization or use of E. coli strains with extra tRNAs (e.g., Rosetta strains) may be necessary for efficient expression .

What purification strategies work best for recombinant B. adolescentis LspA?

Purifying recombinant B. adolescentis LspA requires specialized approaches due to its membrane-embedded nature:

  • Membrane isolation: After cell lysis, differential centrifugation separates membrane fractions containing the expressed LspA.

  • Detergent extraction: Screen multiple detergents for optimal solubilization:

    • Mild detergents: n-dodecyl-β-D-maltoside (DDM), n-decyl-β-D-maltoside (DM)

    • Harsh detergents: Triton X-100, sodium dodecyl sulfate (SDS)

  • Affinity chromatography: For His-tagged constructs, Ni-NTA affinity chromatography in the presence of detergent is recommended. Critical washing steps with low imidazole concentrations (20-40 mM) remove non-specifically bound proteins while maintaining LspA binding .

  • Size exclusion chromatography: A polishing step using size exclusion chromatography equilibrated with detergent-containing buffer separates properly folded protein from aggregates and removes detergent micelles.

  • Protein quality assessment: Verify proper folding using circular dichroism spectroscopy and activity assays before using the purified protein for functional studies.

When handling purified LspA, maintaining a stable detergent concentration above the critical micelle concentration throughout all purification steps is essential for protein stability and activity .

How can the enzymatic activity of recombinant B. adolescentis LspA be measured in vitro?

Several complementary approaches can be employed to measure the enzymatic activity of recombinant B. adolescentis LspA:

  • Fluorogenic peptide substrates: Design custom peptides spanning the signal peptide-mature domain junction of known B. adolescentis lipoproteins, with fluorophore-quencher pairs positioned to release fluorescence upon cleavage.

  • MALDI-TOF mass spectrometry: Incubate purified LspA with synthetic lipopeptide substrates and monitor the appearance of cleaved products by mass spectrometry over time.

  • SDS-PAGE mobility shift assay: Detect the change in electrophoretic mobility of lipoproteins before and after signal peptide cleavage.

  • Inhibition assays: Measure the susceptibility of recombinant LspA to known inhibitors like globomycin or myxovirescin to confirm functional enzyme production. A typical inhibition assay protocol would include:

    • Pre-incubation of purified LspA with various concentrations of inhibitor (0-100 μM)

    • Addition of substrate and measurement of remaining activity

    • Determination of IC50 values by plotting percent inhibition versus inhibitor concentration

Kinetic parameters (Km, Vmax, kcat) can be determined using varying substrate concentrations and initial velocity measurements, which are crucial for comparing enzymatic efficiency with LspA from other bacterial species .

What are the catalytic mechanisms of LspA and how can they be investigated in B. adolescentis?

The proposed catalytic mechanism of LspA involves an aspartyl protease-like action, which can be investigated in B. adolescentis through:

  • Site-directed mutagenesis: Create point mutations of the conserved catalytic aspartate residues and other conserved amino acids to assess their roles in catalysis. The proposed mechanism includes:

    • Proton abstraction from water by one aspartyl residue

    • Nucleophilic attack by the hydroxide ion on the scissile peptide bond

    • Formation of a tetrahedral intermediate

    • Proton transfer and peptide bond cleavage

  • pH-dependency studies: Determine the optimal pH for enzyme activity to understand the protonation states of catalytic residues.

  • Substrate analogs: Use non-cleavable substrate analogs to trap intermediates for structural studies.

  • Molecular dynamics simulations: Model the reaction pathway and energy landscape based on the crystal structure.

  • Isotope effects: Employ kinetic isotope effects with deuterated substrates to identify rate-limiting steps in the reaction.

The following table summarizes the proposed catalytic steps for LspA:

StepDescriptionCatalytic Residues Involved
1Proton abstraction from waterFirst aspartate residue
2Nucleophilic attack on carbonyl carbonActivated water molecule
3Formation of tetrahedral intermediateBoth aspartate residues
4Proton transfer to amide nitrogenFirst aspartate residue
5Peptide bond cleavageSecond aspartate residue

These approaches would provide detailed insights into the specific catalytic mechanism of B. adolescentis LspA .

How does substrate specificity of B. adolescentis LspA compare to other bacterial species?

Investigating substrate specificity differences between B. adolescentis LspA and other bacterial species requires systematic approaches:

  • Comparative sequence analysis: Align lipobox motifs from known B. adolescentis lipoproteins with those from other bacteria to identify unique features.

  • Cross-species substrate testing: Express recombinant LspA from B. adolescentis and other bacteria (e.g., E. coli, P. aeruginosa, S. aureus) and test their activities on a panel of lipopeptide substrates derived from different species.

  • Chimeric enzyme construction: Create chimeric LspA enzymes with domains swapped between B. adolescentis and other species to identify regions responsible for substrate preferences.

  • Structural modeling and docking: Using available crystal structures of LspA from P. aeruginosa and S. aureus as templates, build homology models of B. adolescentis LspA and perform substrate docking to predict binding interactions .

The unique environment of B. adolescentis as a gut commensal likely shaped the evolution of its LspA substrate specificity. B. adolescentis possesses an extensive repertoire of carbohydrate transporters and degradation enzymes, many of which may be lipoproteins requiring processing by LspA . Differences in substrate specificity could reflect adaptations to the intestinal environment and specific lipoproteins involved in host interactions.

How does LspA activity affect the adhesive properties of B. adolescentis to intestinal epithelial cells?

The relationship between LspA activity and adhesive properties of B. adolescentis can be investigated through the following methodological approaches:

  • Gene knockout/knockdown studies: Creating LspA-deficient mutants or conditional mutants to observe changes in adhesion capacity. This approach must consider that LspA may be essential for viability, necessitating carefully controlled expression systems.

  • Chemical inhibition: Using specific LspA inhibitors like globomycin at sub-lethal concentrations to partially inhibit LspA activity and measure effects on adhesion .

  • Lipoprotein profiling: Comparing the surface-exposed lipoprotein profile of wild-type and LspA-inhibited B. adolescentis using proteomics to identify specific adhesins affected by LspA processing.

  • Adhesion assays: Quantifying bacterial adhesion to intestinal epithelial cell lines (e.g., Caco-2, HT-29) under various conditions of LspA activity. Evidence suggests that in bifidobacteria, adhesion to intestinal epithelial cells is mediated by proteinaceous components, including lipoproteins like BopA in B. bifidum .

  • Recombinant lipoprotein expression: Expressing and purifying specific B. adolescentis lipoproteins in their properly processed form (requiring functional LspA) to test their individual contributions to adhesion.

Research with B. bifidum has shown that lipoproteins can function as adhesins, with pronase treatment significantly reducing adhesion capacity . Similar mechanisms likely exist in B. adolescentis, with LspA playing a critical role in processing these adhesion-mediating lipoproteins.

What role does LspA play in B. adolescentis stress response and survival in the gut environment?

LspA's role in B. adolescentis stress response and gut survival can be investigated through:

  • Stress challenge assays: Exposing wild-type and LspA-inhibited B. adolescentis to various stressors found in the gut:

    • Bile acids (0.1-0.5%)

    • Acidic pH (pH 4.5-6.5)

    • Oxygen exposure (microaerobic conditions)

    • Osmotic stress (varying NaCl concentrations)

    • Temperature fluctuations (37-40°C)

  • Transcriptomic analysis: RNA-seq comparing gene expression profiles between normal and LspA-inhibited conditions under stress to identify stress-response pathways dependent on properly processed lipoproteins.

  • In vivo colonization models: Using gnotobiotic mouse models to compare colonization efficiency and persistence of wild-type versus LspA-inhibited B. adolescentis strains.

  • Co-culture experiments: Testing survival and competitive fitness in the presence of other gut microbes with and without LspA inhibition.

B. adolescentis thrives in the anaerobic environment of the human large intestine and is specialized in fermenting plant-derived glycans, particularly resistant starch . The proper function of nutrient transporters and other membrane proteins, many of which are lipoproteins requiring LspA processing, is likely essential for the species to maintain its ecological niche in the complex gut environment.

How can recombinant B. adolescentis LspA be utilized for developing novel antimicrobials?

Recombinant B. adolescentis LspA can serve as a platform for antimicrobial development through multiple research approaches:

  • Comparative structural analysis: Solving the crystal structure of B. adolescentis LspA and comparing it with pathogen LspA structures to identify structural differences that could be exploited for selective inhibition of pathogenic bacteria while preserving beneficial bifidobacteria.

  • High-throughput screening: Developing assays using recombinant B. adolescentis LspA to screen compound libraries for molecules that selectively inhibit pathogen LspA enzymes but not bifidobacterial LspA.

  • Structure-guided drug design: Using the insights from LspA crystal structures to design inhibitors that specifically target pathogenic bacterial LspA while sparing beneficial bacteria like B. adolescentis .

  • Natural product investigation: Screening for natural compounds that modulate LspA activity with different specificities between pathogenic and beneficial bacteria.

LspA inhibitors like globomycin and myxovirescin have already been identified as natural product inhibitors of this enzyme . Understanding the structural and functional differences between B. adolescentis LspA and pathogen LspA could guide the development of narrow-spectrum antimicrobials that target specific pathogens while preserving the beneficial gut microbiota.

What methodologies can be used to identify the complete lipoprotein repertoire processed by LspA in B. adolescentis?

A comprehensive identification of the B. adolescentis lipoprotein repertoire requires multi-faceted approaches:

  • Bioinformatic prediction: Using lipoprotein prediction algorithms like LipoP or PRED-LIPO to scan the B. adolescentis genome for potential lipoproteins with characteristic lipobox motifs.

  • Comparative proteomics:

    • Membrane fraction analysis with and without LspA inhibition

    • Stable isotope labeling by amino acids in cell culture (SILAC) to quantitatively compare proteins affected by LspA inhibition

    • Enrichment of lipoproteins using selective biotinylation techniques

  • Metabolic labeling: Using fatty acid analogs with click chemistry reporters to selectively label lipoproteins for enrichment and identification.

  • Genetic approaches: Creating a library of lipoprotein signal sequence reporters fused to a detectable protein to validate processing by LspA in vivo.

The resulting dataset would provide crucial information about the functional categories of lipoproteins in B. adolescentis, enhancing our understanding of how this beneficial microbe interacts with its environment and host. This information could be presented in a taxonomic distribution table showing the functional categories of predicted lipoproteins:

Functional CategoryNumber of Predicted LipoproteinsPercentage of Total
Nutrient transport/binding~~
Cell envelope maintenance~~
Adhesion and host interaction~~
Stress response~~
Unknown function~~

This comprehensive lipoprotein map would provide valuable insights into B. adolescentis biology and potential applications in probiotic enhancement .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.