Recombinant Bifidobacterium adolescentis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
In general, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; BAD_0792; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Target Names
lgt
Target Protein Sequence
MTLAYIPSPTISQFSIGPVTIHFYALCILLGIVLAVWMTTVHWKRYGGNFDQILDITLVA VPSGIIGARIYHIITTPERFFGPTGDWVEMFRIWNGGLGIWGGVLLGALAAWAWCRHKHY PMALLGDAVAPGLLVAQAVGRLGNWFNQELYGAPTTLPWGLKLNMEGSAIGHSEQCYDGA TCPTGTLFHPTFLYEMIWNLIGAALIVFLGSKIMKKLKAGSLFAIYIMWYTVGRTWIEAL RIDFAHEFLGVRINVWVSMAVFVLGVVAFIVIQQMGKSTELLAEKLRTVTEIELSLVEDG ETGLPTAKANLTKTKDEITANDGSSVSYADDQSDNK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of prolipoprotein diacylglyceryl transferase (Lgt) in Bifidobacterium adolescentis?

Prolipoprotein diacylglyceryl transferase (Lgt) in B. adolescentis performs the essential first step in bacterial lipoprotein biosynthesis. It catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in the lipobox motif of prolipoproteins. This post-translational modification anchors lipoproteins to the bacterial membrane, which is crucial for membrane integrity, nutrient uptake, and host-microbe interactions. The lipoprotein modification pathway is unique to bacteria and is considered an excellent target for the development of novel antibacterials due to its essentiality for bacterial viability and virulence .

The biological importance of Lgt in B. adolescentis likely extends beyond basic cellular function, as B. adolescentis strains have shown significant effects on host metabolism, including modulation of gut microbiota composition, thermogenesis, and lipid metabolism regulation. Properly functioning lipoproteins are essential mediators of these bacterial-host interactions that contribute to B. adolescentis' beneficial effects on reducing inflammation and improving metabolic health .

How does the structure of B. adolescentis Lgt compare to that of other bacterial species?

While the specific structure of B. adolescentis Lgt has not been comprehensively characterized in the provided research, comparative analysis can be made based on known Lgt structures from other bacteria. Lgt typically consists of a compact integral membrane enzyme composed of seven transmembrane domains (forming the "body"), two arms that align on top of the cytoplasmic membrane, and a periplasmic domain (termed the "head") .

The central cavity of Lgt contains essential residues for the diacylglyceryl transfer reaction. Critical residues identified in E. coli Lgt include Y26 (located in TM-1), H103 (essential for catalytic function), R143 and N146 (in TM-4), G154 (in the loop between TM-4 and head domain), and R239 (in TM-6) . These residues are likely conserved in B. adolescentis Lgt due to their essential nature, though species-specific variations may exist that account for substrate specificity differences.

Based on evolutionary conservation patterns of essential enzymes, B. adolescentis Lgt likely shares the core structural elements with other bacterial Lgt proteins while potentially possessing unique features reflecting its adaptation to the human intestinal environment and its specific lipoprotein substrates.

What methods are most effective for expressing recombinant B. adolescentis Lgt in laboratory settings?

For effective expression of recombinant B. adolescentis Lgt, researchers should consider the following methodological approaches:

  • Expression System Selection: E. coli expression systems are commonly used for recombinant membrane protein production. For B. adolescentis Lgt, E. coli strains like BL21(DE3) or C41(DE3) (specifically designed for membrane protein expression) are recommended .

  • Vector Design: Vectors containing inducible promoters (like T7) with appropriate affinity tags (His6, FLAG) positioned to avoid interference with transmembrane domains are optimal. The pET vector system has been successfully used for similar membrane proteins.

  • Optimization Parameters:

    • Induction at lower temperatures (16-25°C)

    • Reduced inducer concentrations

    • Extended expression periods (overnight)

    • Use of specialized media formulations

  • Solubilization Strategy: Since Lgt is a membrane protein with seven transmembrane domains, effective solubilization requires careful detergent selection. Mild detergents like n-dodecyl-β-D-maltopyranoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are recommended.

  • Purification Protocol: A two-step purification process employing immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography typically yields the highest purity.

Validation of properly folded and functional recombinant Lgt can be performed through activity assays measuring the transfer of diacylglyceryl moiety to synthetic peptide substrates containing the lipobox motif.

How do mutations in the catalytic domain of B. adolescentis Lgt affect substrate specificity and enzymatic activity?

Mutations in the catalytic domain of B. adolescentis Lgt can significantly impact both substrate specificity and enzymatic activity. Based on structural and functional studies of Lgt from other bacterial species, several key residues merit investigation in B. adolescentis Lgt:

The catalytic mechanism of Lgt involves a central role for histidine 103 together with other residues that interact with the polar headgroup of phosphatidylglycerol . Site-directed mutagenesis studies in E. coli have identified several essential residues: Y26, H103, R143, N146, G154, and R239 . These residues are critical for Lgt function, as mutations in these positions rendered the enzyme non-functional and caused cell lysis.

ResidueLocationEffect of MutationFunctional Importance
Y26TM-1Non-viableSubstrate binding
H103TM-3Growth to mid-exponential phase, then lysisCentral catalytic residue
R143TM-4Non-viableSubstrate recognition
N146TM-4Non-viableSubstrate recognition
G154Loop between TM-4 and headNon-viableStructural flexibility
R239TM-6Non-viableCatalytic pocket integrity
G98Between arm-2 and TM-3Delayed growthStructural positioning
G104TM-3Delayed growthAdjacent to catalytic H103
E151Loop between TM-4 and headDelayed growthSecondary catalytic role

Mutations in the arm and head domains particularly influence substrate specificity, as these regions are involved in recognizing and binding prolipoproteins . For B. adolescentis Lgt specifically, investigating these mutations would provide insights into how this enzyme might process unique lipoproteins involved in the probiotic and metabolic functions of this beneficial gut bacterium.

What role does B. adolescentis Lgt play in the bacterium's intrinsic antibiotic resistance mechanisms?

B. adolescentis demonstrates intrinsic resistance to several antibiotics, including rifamycin (RIF) . While the direct role of Lgt in this resistance has not been fully characterized, several potential mechanisms deserve investigation:

  • Lipoprotein-Mediated Resistance: Lgt catalyzes the first step in lipoprotein modification, producing mature lipoproteins that may function as efflux pumps or antibiotic binding/sequestration proteins. The proper anchoring of these lipoproteins to the membrane is essential for their function in antibiotic resistance.

  • Cell Envelope Integrity: Properly processed lipoproteins contribute to cell envelope integrity, potentially limiting antibiotic penetration. B. adolescentis has shown considerable resistance to RIF across all tested concentrations , suggesting envelope-mediated exclusion mechanisms.

  • Interaction with Other Resistance Mechanisms: B. adolescentis harbors mutations in the rpoβ gene (both in and outside the RIF pocket) , conferring resistance to rifamycin. The interaction between Lgt-modified lipoproteins and these mutated RNA polymerase components requires further investigation.

  • Adaptive Resistance Development: B. adolescentis demonstrates adaptive responses to antibiotic exposure, including shortened lag times in growth curves when exposed to osmolytes and RIF . The role of Lgt in regulating this adaptation response through lipoprotein modification could be significant.

  • Beta-lactam Resistance: All B. adolescentis strains have shown ability to reduce the development of beta-lactam resistance . This suggests a potential role for Lgt in modulating responses to beta-lactam antibiotics through properly functioning lipoproteins.

Understanding these mechanisms could provide insights for developing targeted antimicrobials that spare beneficial gut bacteria like B. adolescentis while targeting pathogens.

How does the substrate specificity of B. adolescentis Lgt differ from Lgt in pathogenic bacteria, and can these differences be exploited for selective antimicrobial development?

The substrate specificity of Lgt is determined primarily by the arm and head domains of the enzyme . These structural elements recognize the lipobox motif in prolipoproteins and position them for the diacylglyceryl transfer reaction. Comparative analysis suggests potentially exploitable differences between B. adolescentis Lgt and pathogenic bacterial Lgt:

  • Lipobox Motif Recognition: B. adolescentis, as a beneficial gut commensal, likely possesses unique lipoproteins involved in metabolic functions and host interactions that differ from virulence-associated lipoproteins in pathogens. These differences may be reflected in the substrate binding sites of Lgt.

  • Structural Variations: The arm and head domains in Lgt show greater sequence variability between bacterial species compared to the highly conserved transmembrane domains . These variations could be exploited to develop inhibitors that selectively target pathogenic bacteria while sparing beneficial bacteria like B. adolescentis.

  • Binding Pocket Architecture: The central cavity of Lgt contains essential residues for catalysis, but the exact arrangement and properties of these residues may differ between species, affecting inhibitor binding affinity.

  • Inhibitor Development Strategy:

Targeting ApproachPotential AdvantageResearch Consideration
Arm domain-specific inhibitorsHigher species selectivityRequires detailed structural comparison
Central cavity analogsHigher potencyMay have broader spectrum activity
Allosteric inhibitorsNovel mechanism of actionNeed to identify B. adolescentis-specific allosteric sites
Substrate competitionMimicking natural substratesRequires characterization of B. adolescentis lipobox motifs

Recent development of Lgt inhibitors like cyclic peptide G2428 and small molecule MAC-0452936 that inhibit Lgt activity in vitro provides templates for developing selective antimicrobials. These could be modified to preferentially target pathogenic bacteria while sparing beneficial bacteria like B. adolescentis.

What are the key considerations for designing an activity assay for recombinant B. adolescentis Lgt?

Designing a robust activity assay for recombinant B. adolescentis Lgt requires careful consideration of several biochemical and methodological factors:

  • Substrate Selection:

    • Phospholipid donor: Typically phosphatidylglycerol (PG) is the preferred diacylglyceryl donor. Using radiolabeled [14C]-PG or fluorescently labeled PG analogs enables sensitive detection of transfer activity.

    • Prolipoprotein acceptor: Synthetic peptides containing the lipobox motif (L-[A/S/T]-[G/A]-C) can serve as minimal substrates. For B. adolescentis-specific activity, peptides derived from known B. adolescentis lipoproteins would be ideal.

  • Assay Format Options:

Assay TypeDetection MethodAdvantagesLimitations
Radiolabeled transferScintillation countingHigh sensitivityRequires radioactive materials
Fluorescence-basedFluorescence spectroscopyReal-time monitoringPotential fluorophore interference
Mass spectrometryMS detection of modified peptidesDirect product identificationComplex data analysis
HPLC separationUV/Vis detectionQuantitative analysisLower throughput
Coupled enzyme assayColorimetric/fluorometricContinuous monitoringPotential interference from coupling enzymes
  • Reaction Conditions Optimization:

    • Buffer composition: Test phosphate, HEPES, and Tris buffers at pH 7.0-8.0

    • Detergent concentration: Critical for maintaining Lgt solubility without disrupting activity

    • Divalent cations: Investigate the effects of Mg2+ and Ca2+ on activity

    • Temperature: Optimal temperature likely 30-37°C reflecting B. adolescentis growth conditions

    • Incubation time: Establish linear range of product formation

  • Controls and Validation:

    • Negative controls: Heat-inactivated enzyme, reaction without enzyme or substrate

    • Positive controls: Well-characterized Lgt from E. coli if available

    • Inhibition controls: Known Lgt inhibitors like cyclic peptide G2428 or MAC-0452936

    • Site-directed mutants: H103Q mutation should significantly reduce activity based on homology

  • Product Analysis:

    • TLC (thin-layer chromatography) for separation of lipidated products

    • LC-MS/MS for definitive identification of diacylglyceryl-modified peptides

    • Western blotting using anti-diacylglyceryl antibodies for protein substrates

Optimizing these parameters will yield a reliable assay for characterizing B. adolescentis Lgt activity and screening potential inhibitors or substrate variants.

How can researchers effectively analyze the impact of B. adolescentis Lgt on host metabolism and gut microbiota?

To comprehensively analyze the impact of B. adolescentis Lgt on host metabolism and gut microbiota, researchers should implement a multi-faceted experimental approach:

  • Genetic Manipulation Strategies:

    • Generate conditional Lgt mutants in B. adolescentis using CRISPR-Cas9 or other genetic tools

    • Create Lgt-overexpressing strains to assess dose-dependent effects

    • Develop site-directed mutants with altered activity or substrate specificity

  • In Vivo Experimental Design:

    • Animal models: Gnotobiotic mice colonized with defined bacterial communities including wild-type or Lgt-modified B. adolescentis

    • Diet interventions: Challenge with high-fat diet to assess metabolic protection effects

    • Longitudinal sampling: Fecal, serum, and tissue collection at multiple timepoints

  • Metabolic Assessment Parameters:

ParameterMeasurement TechniqueRelevant Findings from Literature
Body weightRegular weighingB. adolescentis strains from elderly decreased body weight in mice
Adipose tissueHistology, gene expressionIncreased thermogenesis and lipid metabolism-related genes in brown adipose tissue
Liver functionHistology, enzyme assays, NAS scoringReduced liver steatosis and steatohepatitis
Serum markersELISA, metabolomicsIncreased serum leptin concentrations
InflammationCytokine profiling, tissue histologyAlleviated inflammation in spleen and brain
FGF21 sensitivityFGF21 response testImproved FGF21 sensitivity and receptor expression
Gut barrier functionFITC-dextran permeability testPreserved gut barrier, reduced LPS
  • Microbiome Analysis Techniques:

    • 16S rRNA sequencing to assess community composition changes

    • Shotgun metagenomics for functional pathway analysis

    • Metabolomics of fecal samples to identify microbial metabolites

    • Focus on tracking changes in Bacteroides, Parabacteroides, and other genera known to be influenced by B. adolescentis

  • Mechanistic Investigation:

    • Transcriptomics of host tissues to identify response pathways

    • Lipidomics to assess changes in lipid profiles

    • Immunophenotyping with focus on Th17 cells known to be induced by B. adolescentis

    • Assessment of TLR4/NF-κB pathway activation in liver tissue

This comprehensive approach would enable researchers to connect the specific function of Lgt in B. adolescentis to broader effects on host metabolism and microbiota composition, elucidating the molecular mechanisms underlying B. adolescentis probiotic effects.

How might recombinant B. adolescentis Lgt or its inhibitors be developed as therapeutic agents for metabolic disorders?

Recombinant B. adolescentis Lgt and related compounds present promising therapeutic potential for metabolic disorders based on several lines of evidence from the research literature:

  • Recombinant Lgt as a Biocatalyst:

    • Production of properly lipidated B. adolescentis proteins that mediate beneficial metabolic effects

    • Engineering enhanced Lgt variants with improved catalytic efficiency or altered substrate specificity

    • Development of cell-free systems for generating therapeutic lipoproteins

  • Targeted Metabolic Pathways:
    B. adolescentis supplementation has demonstrated beneficial effects on several metabolic pathways that could be enhanced through Lgt-mediated approaches:

    Metabolic PathwayB. adolescentis EffectPotential Lgt-Based Intervention
    FGF21 signalingIncreased FGF21 sensitivity, elevated receptor expression (FGFR1, KLB) Lipoproteins enhancing FGF21 receptor expression
    ThermogenesisInduced expression of thermogenesis genes in brown adipose tissue Lipoprotein modulators of UCP1 expression
    Lipid metabolismRegulation of lipid metabolism genes Lipidated enzymes affecting lipid oxidation
    InflammationReduced systemic and tissue inflammation Anti-inflammatory lipopeptides
    Leptin signalingIncreased serum leptin concentrations Lipoproteins enhancing leptin sensitivity
  • NAFLD Treatment Strategies:
    B. adolescentis alleviates non-alcoholic fatty liver disease by multiple mechanisms . Lgt-focused approaches could include:

    • Engineered B. adolescentis with enhanced Lgt activity to improve lipoprotein functions

    • Recombinant lipoproteins specifically targeting hepatic TLR4/NF-κB pathway

    • Selective inhibitors of pathogenic bacterial Lgt while preserving B. adolescentis Lgt

  • Gut Barrier Enhancement:
    B. adolescentis preserves gut barrier function and reduces LPS translocation . Therapeutic applications include:

    • Lipoproteins specifically enhancing tight junction protein expression

    • Lgt-dependent delivery of barrier-enhancing compounds to intestinal epithelium

    • Recombinant bacteria with optimized Lgt activity for enhanced colonization and barrier function

  • Delivery Systems Development:

    • Encapsulation technologies to protect recombinant B. adolescentis with enhanced Lgt

    • Site-specific release formulations targeting different intestinal regions

    • Combination with prebiotics to enhance colonization and activity

These approaches leverage the intrinsic beneficial properties of B. adolescentis while focusing specifically on the role of Lgt in producing functional lipoproteins that mediate metabolic effects. The advantage over conventional probiotics would be enhanced specificity, potency, and mechanistic understanding.

What are the potential immunomodulatory effects of B. adolescentis Lgt and how can they be investigated?

The immunomodulatory effects of B. adolescentis Lgt likely stem from its role in producing mature bacterial lipoproteins that interact with host immune receptors. These effects and investigation methods include:

  • Pattern Recognition Receptor (PRR) Interactions:
    Bacterial lipoproteins are recognized by Toll-like receptor 2 (TLR2), often in heterodimers with TLR1 or TLR6. B. adolescentis lipoproteins may have unique immunomodulatory properties based on their specific acylation patterns determined by Lgt.

    Investigation Methods:

    • Reporter cell lines expressing different TLR combinations

    • Knockout mouse models lacking specific TLRs

    • Structural analysis of Lgt-modified lipoproteins binding to TLR crystal structures

  • Th17 Cell Induction:
    B. adolescentis specifically induces intestinal Th17 cell accumulation , resembling effects of FGF21 analogues on liver Th17 cells. The role of Lgt-modified lipoproteins in this process warrants investigation.

    Investigation Methods:

    • Flow cytometry of intestinal lymphocytes from gnotobiotic mice colonized with wild-type or Lgt-modified B. adolescentis

    • Ex vivo culture of intestinal immune cells with purified lipoproteins

    • RORγt reporter systems to track Th17 differentiation

  • Anti-inflammatory Properties:
    B. adolescentis strains alleviate inflammation in the spleen and brain , suggesting systemic immunomodulatory effects.

    Investigation Methods:

    • Cytokine profiling in multiple tissues

    • NF-κB reporter systems to assess inflammatory signaling

    • Histological assessment of inflammatory cell infiltration

    • Transcriptomic analysis of immune cell populations

  • Gut-Brain Axis Modulation:
    B. adolescentis is a key producer of GABA with potential implications for gut-brain axis interactions . The role of Lgt-modified lipoproteins in neurotransmitter production or neurotrophic effects requires investigation.

    Investigation Methods:

    • Neurotransmitter quantification in intestinal and brain tissues

    • Behavioral testing in animal models receiving wild-type or Lgt-modified B. adolescentis

    • Vagal nerve recording to assess gut-brain signaling

  • Experimental Matrix for Comprehensive Assessment:

Immune ParameterIn Vitro MethodsEx Vivo MethodsIn Vivo Methods
Innate immunityTLR reporter assays, macrophage activationIntestinal explant culturesNeutrophil recruitment, phagocytosis assays
Adaptive immunityT cell differentiation assaysMLN cell restimulationFlow cytometry of intestinal T cell subsets
Mucosal immunityEpithelial cell barrier modelsIntestinal organoidsIgA production, Peyer's patch analysis
Systemic immunityPBMC stimulation assaysSplenic cell culturesSerum cytokine profiling, challenge models
NeuroinflammationMicroglial activation assaysBrain slice culturesBehavioral testing, brain histology

By systematically investigating these parameters, researchers can delineate the specific contributions of B. adolescentis Lgt to immunomodulation, potentially leading to novel immunotherapeutic approaches for inflammatory and autoimmune conditions.

What are the main challenges in expressing and purifying functional recombinant B. adolescentis Lgt, and how can they be overcome?

Expressing and purifying functional recombinant Lgt from B. adolescentis presents several technical challenges due to its nature as a multi-transmembrane domain protein. These challenges and potential solutions include:

  • Membrane Protein Solubility Challenges:

    Lgt contains seven transmembrane domains forming a compact integral membrane structure , making it inherently difficult to express and maintain in a soluble, properly folded state.

    Solutions:

    • Fusion tags: N-terminal MBP (maltose binding protein) or C-terminal GFP fusion to enhance solubility

    • Specialized expression strains: C41(DE3) or C43(DE3) E. coli strains designed for membrane protein expression

    • Controlled expression rate: Lower temperature (16-20°C), reduced IPTG concentration (0.1-0.5 mM)

    • Membrane scaffold proteins: Co-expression with membrane scaffold proteins for nanodisc formation

  • Detergent Selection Critical Parameters:

    Detergent ClassExamplesAdvantagesDisadvantages
    Mild non-ionicDDM, LMNGPreserve protein structureLess efficient solubilization
    ZwitterionicCHAPS, Fos-cholineBetter solubilizationMay denature protein
    Styrene maleic acid (SMA)SMA copolymersNative lipid environment retainedpH limitations
    DigitoninDigitoninGentle extractionExpensive, variable purity

    Optimization Strategy:

    • Detergent screening panel testing multiple classes at different concentrations

    • Stepwise detergent exchange during purification

    • Addition of cholesterol or specific phospholipids to stabilize protein

  • Functional Activity Preservation:

    Maintaining enzymatic activity through the purification process is challenging.

    Solutions:

    • Liposome reconstitution: Incorporate purified Lgt into liposomes with B. adolescentis lipid composition

    • Substrate addition: Include phosphatidylglycerol during purification

    • Avoid oxidation: Include reducing agents (DTT, β-mercaptoethanol) in buffers

    • Thermal stability screening to identify optimal buffer conditions

  • Expression System Selection:

    E. coli might not provide the optimal cellular environment for B. adolescentis Lgt.

    Solutions:

    • Bifidobacterial expression systems: Develop vectors for expression in B. adolescentis or related species

    • Cell-free expression systems: Membrane protein-optimized cell-free systems with supplied lipids

    • Methylotrophic yeast: Pichia pastoris for controlled expression with eukaryotic processing machinery

  • Protein Verification Methods:

    Confirming proper folding and activity is essential before functional studies.

    Solutions:

    • Western blot with antibodies against affinity tags and, if available, Lgt-specific antibodies

    • Circular dichroism to verify secondary structure content (high alpha-helical content expected)

    • Thermal shift assays to assess protein stability in different buffer conditions

    • In vitro activity assays using fluorescently labeled substrate peptides

By addressing these challenges systematically, researchers can successfully express and purify functional B. adolescentis Lgt for structural and functional studies, facilitating deeper understanding of its unique properties and potential therapeutic applications.

How can researchers address contradictory findings when studying strain-specific differences in B. adolescentis Lgt?

Addressing contradictory findings when studying strain-specific differences in B. adolescentis Lgt requires a systematic approach to identify sources of variation and resolve discrepancies:

  • Strain Authentication and Characterization:

    Contradictory findings often stem from unclear strain provenance or misidentification.

    Methodological Solutions:

    • Whole genome sequencing of all strains to confirm identity and evolutionary relationships

    • Comparative genomic analysis focusing on Lgt and associated genes

    • Establishing reference sequences for B. adolescentis Lgt from validated type strains

    • Creating a standardized nomenclature system for strain variants

  • Host-Specific Adaptation Analysis:

    B. adolescentis strains from different hosts show varying effects. For example, strains isolated from elderly humans decreased body weight in mice, while strains from newborns increased body weight .

    Resolution Approaches:

    • Sequence comparison of Lgt between strains from different hosts

    • Substrate specificity profiling using synthetic peptide libraries

    • Lipidomic analysis of membrane composition differences

    • Transcriptomic analysis to identify regulatory differences in Lgt expression

  • Standardization of Experimental Variables:

    VariableStandardization ApproachImpact on Data Interpretation
    Growth conditionsDefined media composition, growth phaseAffects membrane composition and Lgt activity
    Expression systemsConsistent vectors and host strainsReduces variability in recombinant protein production
    Purification protocolsStandardized detergents and buffer systemsEnsures comparable protein quality
    Activity assaysReference substrate panel, internal standardsEnables direct comparison between laboratories
    Animal modelsStandardized gnotobiotic models, defined dietsControls for microbiome and dietary variables
  • Data Integration and Meta-analysis Techniques:

    When contradictory findings persist despite methodological standardization, formal meta-analytical approaches become valuable:

    • Systematic review with predefined inclusion criteria

    • Effect size calculation to compare results across studies

    • Multivariate analysis to identify patterns in seemingly contradictory results

    • Bayesian modeling approaches to incorporate prior knowledge and uncertainty

  • Collaborative Resolution Strategies:

    Establishing a consortium approach to address contradictions:

    • Multi-laboratory validation studies with identical protocols and reagents

    • Creation of strain and reagent repositories to ensure consistency

    • Development of consensus guidelines for B. adolescentis Lgt research

    • Preregistration of study designs to reduce publication bias

When specific contradictions arise regarding strain differences, researchers should differentiate between true biological variation (reflecting genuine adaptations to different host environments) and methodological artifacts. The observation that heat-killed B. adolescentis retains some beneficial effects, albeit weaker than live bacteria , suggests that some functions may be structure-dependent rather than requiring active enzyme function, which could explain some contradictory findings when comparing different experimental approaches.

What are the most promising future research directions for B. adolescentis Lgt in therapeutic development?

The investigation of B. adolescentis Lgt opens several promising research avenues for therapeutic development, especially in the fields of metabolic disorders, antibiotic resistance, and immunomodulation. Based on current findings, the following directions show particular promise:

  • Selective Antimicrobial Development:

    The lipoprotein modification pathway represents an excellent target for developing novel antibacterials . B. adolescentis Lgt structural and functional differences from pathogenic bacterial Lgt could be exploited to develop narrow-spectrum antibiotics that target pathogens while preserving beneficial gut bacteria.

    Priority Research Areas:

    • High-resolution structural determination of B. adolescentis Lgt compared to pathogenic bacterial Lgt

    • Identification of substrate binding pocket differences for selective inhibitor design

    • Development of screening platforms for compounds that differentially inhibit pathogenic versus probiotic bacterial Lgt

    • In vivo testing of selective antimicrobials for gut microbiome preservation

  • Engineered Probiotics for Metabolic Disease:

    B. adolescentis strains have demonstrated significant effects on metabolism, including reduced body weight, increased thermogenesis, and protection against non-alcoholic fatty liver disease . Engineered strains with optimized Lgt function could enhance these benefits.

    Priority Research Areas:

    • Creation of B. adolescentis strains with enhanced or modified Lgt activity

    • Identification of specific lipoproteins mediating metabolic effects

    • Development of site-specific delivery systems to target different intestinal regions

    • Clinical trials in metabolic syndrome, obesity, and NAFLD patients

  • Antibiotic Resistance Management:

    B. adolescentis shows intrinsic resistance to antibiotics like rifamycin while reducing the development of beta-lactam resistance . Understanding the role of Lgt in these processes could inform antibiotic stewardship strategies.

    Priority Research Areas:

    • Mechanistic studies of how Lgt-modified lipoproteins contribute to antibiotic resistance

    • Development of adjuvant therapies that preserve B. adolescentis during antibiotic treatment

    • Exploration of B. adolescentis as a reservoir for transferring beneficial resistance traits

    • Clinical studies on microbiome recovery post-antibiotic treatment

  • Immunotherapeutic Applications:

    B. adolescentis has immunomodulatory effects, including inducing intestinal Th17 cell accumulation and alleviating inflammation . Lgt-modified lipoproteins likely play a key role in these effects.

    Priority Research Areas:

    • Isolation and characterization of specific immunomodulatory lipoproteins

    • Development of recombinant lipopeptides as immune response modifiers

    • Investigation of applications in inflammatory bowel disease and autoimmunity

    • Exploration of the gut-brain axis connections through GABA production

These research directions represent the convergence of basic mechanistic understanding of B. adolescentis Lgt with translational applications in multiple therapeutic areas. The greatest promise may lie in approaches that leverage the unique properties of this enzyme to develop highly selective interventions that preserve or enhance the beneficial functions of gut commensals while targeting pathogenic processes.

How might advances in structural biology and computational methods accelerate research on B. adolescentis Lgt?

Recent advances in structural biology and computational methods offer unprecedented opportunities to accelerate research on B. adolescentis Lgt, overcoming traditional challenges in membrane protein research:

The integration of these advanced structural biology and computational methods would enable several breakthroughs in B. adolescentis Lgt research:

  • Elucidation of the precise catalytic mechanism, including identification of transition states and energy barriers

  • Understanding of substrate specificity determinants for rational enzyme engineering

  • Development of highly selective inhibitors through structure-based drug design

  • Prediction of strain-specific functional differences based on sequence variations

  • Design of optimized Lgt variants for enhanced probiotic or therapeutic applications

These advances would dramatically accelerate the translation of basic research on B. adolescentis Lgt into practical applications in medicine and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.