Recombinant Bifidobacterium adolescentis Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Characteristics

Recombinant Bifidobacterium adolescentis Undecaprenyl-diphosphatase (uppP) is a recombinant protein derived from the uppP gene of B. adolescentis strain ATCC 15703 (DSM 20083). It functions as an enzyme critical for dephosphorylating undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), a process essential for bacterial cell wall synthesis and lipid II cycle homeostasis .

Key biochemical properties:

ParameterValue/Description
SpeciesBifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Uniprot IDA1A1M3
Tag InfoDetermined during production (not specified)
Storage BufferTris-based buffer, 50% glycerol
Storage Conditions-20°C (working aliquots: 4°C for ≤1 week)
AA SequenceFull-length sequence provided in

The enzyme’s activity is linked to bacitracin resistance, as UPP phosphatases compete with bacitracin for UPP binding .

Cell Wall Synthesis and Stress Response

UppP is part of the Lipid II cycle, where UP is recycled to shuttle cell wall precursors (e.g., peptidoglycan) across membranes. This process is critical for maintaining cell wall integrity and responding to envelope stress .

Key mechanisms:

  1. UPP Recycling: Dephosphorylates UPP to UP, enabling lipid II regeneration.

  2. Antibiotic Resistance: Bacitracin binds UPP, inhibiting dephosphorylation; UppP competes with bacitracin for UPP, modulating resistance .

  3. Cell Membrane Potential: B. adolescentis exhibits reduced membrane potential under stress (e.g., TNF-α exposure), suggesting UppP’s role in membrane stability .

Genetic and Phenotypic Variability

Genomic studies reveal strain-specific diversity in B. adolescentis:

  • Pan-genome analysis shows 4,448 COGs, indicating extensive genetic variability .

  • RS-degrading strains (e.g., P2P3) exhibit unique carbohydrate-active enzymes, though direct links to uppP remain unexplored .

Experimental Observations

StudyKey FindingsSource
B. adolescentis viabilityDecreased live population in TNF-α environments
B. subtilis uppP mutantsSynthetic lethality with bcrC deletion; sporulation defects
UPPS inhibitorsGram-positive bacteria susceptibility (e.g., B. anthracis, MRSA)

Diagnostic and Therapeutic Potential

  • ELISA Kits: Recombinant UppP is used in immunoassays to detect antibodies or study protein interactions .

  • Antibiotic Synergy: UPPS inhibitors (e.g., epalrestat analogs) show promise in targeting Gram-positive pathogens .

Challenges and Future Directions

  1. Strain-Specific Activity: Variability in B. adolescentis genomes may influence UppP expression and function .

  2. UPP Recycling vs. De Novo Synthesis: Limited data on UppP’s role in replenishing UP via undecaprenol kinase (DgkA) pathways .

  3. Gut Microbiota Interactions: B. adolescentis’ role in RS degradation and its interplay with UppP in gut environments requires further study .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type, please inform us and we will prioritize developing the specified tag.
Synonyms
uppP; bacA; BAD_0825; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-294
Protein Length
full length protein
Species
Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Target Names
uppP
Target Protein Sequence
MNFFQAIFLGLVQALTEYLPVSSSAHIRIIGDLMLGSDPGAAFTAIIQIGTELAVILYFR HDIIRILGAWFGSLFGKEGKDFKSRMGAHNRDTQMGWFIIIGTLPILIAGLLFKDAIEST LRNLWITVTVLIIFGILLWVVDARAKQVKTMDEMTWKDALIFGIGQMLALIPGVSRSGGT ITFGRAMGYTREAAVRVSFLMAIPAVFGAGILEAVSAVKDVAAGNAGMFPGWGATIAATI VAFVVGYVVIIGFLKFVSTFSYKAFAIYRIALAVVVALLLICGVLHPTEVVAAA
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Undecaprenyl-diphosphatase (UppP) in Bifidobacterium adolescentis?

UppP in B. adolescentis functions as a critical phosphatase enzyme that dephosphorylates undecaprenyl pyrophosphate (UPP) to generate undecaprenyl phosphate (UP), an essential carrier lipid in bacterial cell wall biosynthesis. This conversion is vital for recycling the lipid carrier and maintaining continuous peptidoglycan synthesis. Research indicates that UppP activity is essential for bacterial viability when other UPP phosphatases are absent or compromised, highlighting its role in maintaining cell envelope integrity. The enzyme participates in a crucial step of the lipid II cycle that affects cell morphology, division, and antibiotic resistance .

How does UppP differ from other phosphatases in the bacterial cell wall synthesis pathway?

UppP belongs to a distinct family of membrane-embedded phosphatases that specifically recognize UPP as a substrate. Unlike other phosphatases like BcrC, UppP appears to have distinct regulatory mechanisms and substrate specificity. Experimental evidence from related bacteria suggests that while both UppP and BcrC can dephosphorylate UPP, they respond differently to environmental conditions and stress responses. For instance, BcrC expression is often induced under cell envelope stress conditions, while UppP may be constitutively expressed. Additionally, UppP may have different membrane localization patterns compared to other phosphatases, affecting its accessibility to substrates within the membrane environment .

What genetic elements are typically used to express recombinant UppP in Bifidobacterium systems?

For recombinant expression of UppP in Bifidobacterium systems, researchers typically employ specialized Bifidobacterium-compatible expression vectors. These vectors usually contain:

  • Bifidobacterium-specific promoters (either constitutive or inducible)

  • Appropriate selection markers for Bifidobacterium

  • Compatible origin of replication

The choice of promoter significantly impacts expression levels. Based on studies with other genes in Bifidobacterium, constitutive promoters like Pgap (glyceraldehyde-3-phosphate dehydrogenase) show efficient expression across growth phases, while native promoters (Pori) may be condition-dependent and often show lower basal expression. When constructing recombinant UppP systems, codon optimization for Bifidobacterium usage bias is essential for optimizing expression levels .

How does the deletion or overexpression of UppP affect cell wall homeostasis in Bifidobacterium adolescentis?

The deletion or severe depletion of UppP in bacteria creates significant cell wall defects, particularly when other UPP phosphatases like BcrC are also compromised. Studies in related bacteria demonstrate that UppP depletion leads to:

  • Altered cell morphology (cell elongation, irregular shape)

  • Defective cell division

  • Increased susceptibility to cell wall-targeting antibiotics

  • Activation of cell envelope stress responses

These phenotypes reflect UP shortage, which limits peptidoglycan and teichoic acid synthesis. Conversely, UppP overexpression can increase resistance to cell wall-active antibiotics such as bacitracin by maintaining higher UP pools. The precise effects in B. adolescentis would require specific experimental validation, but based on data from other bacteria, we can anticipate similar physiological impacts .

What is the relationship between UppP activity and antibiotic resistance, particularly against cell wall-targeting antibiotics?

UppP activity directly influences resistance to antibiotics that target the bacterial cell wall biosynthesis pathway, particularly those binding to UPP, such as bacitracin. Research indicates that UppP overexpression can significantly increase resistance to bacitracin by:

  • Increasing the available UP pool through enhanced UPP dephosphorylation

  • Compensating for UPP sequestration by bacitracin

  • Maintaining lipid II cycle functionality under antibiotic stress

The minimum inhibitory concentration (MIC) testing of bacitracin in bacteria with varying UppP levels demonstrates that UppP activity correlates with resistance levels. In studies with related bacteria, UppP depletion reduces bacitracin MIC values substantially (from >256 μg/ml to approximately 120 μg/ml in wildtype vs. phosphatase-limited strains) .

How does the synthetic lethality between UppP and other phosphatases inform experimental approaches?

The synthetic lethality observed between UppP and BcrC phosphatases indicates that these enzymes provide functionally redundant but essential activities. This relationship necessitates specific experimental approaches:

  • Conditional expression systems: When studying UppP function, researchers should employ inducible promoters (such as xylose-inducible systems) to control expression levels precisely.

  • Time-course analyses: Depletion experiments must include careful time-course analyses to distinguish primary from secondary effects.

  • Suppressor screening: The synthetic lethality creates selective pressure for suppressor mutations, which can be identified through genomic sequencing and provide valuable insights into related pathways.

  • Compensatory expression: Experiments should include controls with complementary expression of alternative phosphatases to confirm specificity.

This synthetic lethality relationship underscores the essential nature of UPP dephosphorylation and suggests that experimental designs must carefully account for potential redundancy and compensatory mechanisms .

What are the optimal conditions for expressing recombinant UppP in Bifidobacterium adolescentis?

Based on research with recombinant protein expression in Bifidobacterium species, the following conditions typically yield optimal expression of membrane proteins like UppP:

ParameterOptimal ConditionNotes
Growth mediumMRS supplemented with cysteine (0.05%)Provides rich nutrients and reducing conditions
Temperature37°CStandard growth temperature for Bifidobacterium
pH5.8-6.2Slightly acidic environment preferred by Bifidobacterium
Growth phaseMid to late exponential phaseBalances biomass accumulation and expression efficiency
OxygenStrictly anaerobic conditionsCritical for Bifidobacterium viability
Induction timingOD600 of 0.4-0.6For inducible promoter systems

For recombinant UppP expression specifically, construct design is crucial. Using constitutive promoters like Pgap has shown efficient expression across multiple Bifidobacterium species, with conversion efficiencies of expressed proteins reaching 84-97% for similar enzymes .

What methods are most effective for measuring UppP activity in Bifidobacterium preparations?

Several complementary methods can be employed to measure UppP activity in Bifidobacterium:

  • Radiochemical assays: Using 32P-labeled UPP substrates and measuring dephosphorylation rates via thin-layer chromatography.

  • Colorimetric phosphate release assays: Measuring released inorganic phosphate using malachite green or other phosphate-detection reagents.

  • HPLC analysis: Separating and quantifying UPP and UP using reverse-phase HPLC.

  • Indirect reporter systems: Monitoring stress response reporters (like P* promoter activity) that respond to changes in UPP/UP levels.

  • Mass spectrometry: Providing precise quantification of lipid intermediates.

Each method has specific advantages and limitations. For membrane-bound enzymes like UppP, preparation of appropriate membrane fractions is crucial for maintaining native activity. Detergent solubilization must be carefully optimized to retain enzyme function while allowing substrate accessibility .

How can genetic manipulation approaches be optimized for studying UppP in Bifidobacterium adolescentis?

Genetic manipulation of Bifidobacterium adolescentis presents specific challenges that require tailored approaches:

  • Restriction-modification barriers: B. adolescentis possesses restriction-modification systems that limit transformation efficiency. To overcome this:

    • Use methylated plasmid DNA matching the host methylation pattern

    • Employ plasmid artificial modification (PAM) systems

    • Consider electroporation protocols optimized for Bifidobacterium

  • Complete deletion verification: When creating UppP deletion mutants, complete allelic replacement via double homologous recombination is essential, as single crossover events can lead to residual activity from gene fragments.

  • Complementation controls: Due to potential polar effects, complementation studies should include both native promoter and ectopic expression controls.

  • Inducible systems: For essential genes like UppP, inducible systems with minimal leakiness are crucial:

    • Xylose-inducible promoters show good regulation in Bifidobacterium

    • Tetracycline-responsive systems may provide tighter control

  • Marker selection: Appropriate antibiotic resistance markers compatible with Bifidobacterium physiology should be selected .

How does UppP from Bifidobacterium adolescentis compare with homologs from other bacterial species?

UppP from B. adolescentis shares fundamental functions with homologs from other bacteria but displays species-specific characteristics:

SpeciesUppP CharacteristicsFunctional Differences
B. adolescentisMembrane-integrated phosphatasePotentially specialized for acidic intestinal environment
B. subtilisFunctions cooperatively with BcrCSynthetic lethality with BcrC deletion
E. coliKnown as BacAHigher sequence conservation with B. adolescentis UppP
S. aureusUP phosphatase activity detectedActivity not clearly assigned to specific protein
B. longumSimilar to B. adolescentisMay have species-specific regulation

These differences likely reflect adaptation to different cell envelope compositions and environmental niches. The UppP proteins exhibit varying degrees of substrate specificity and regulation, though the core UPP dephosphorylation function remains conserved. Understanding these differences is crucial when designing cross-species experiments or interpreting heterologous expression results .

What is the relationship between UppP activity and cell morphology in Bifidobacterium?

UppP activity directly impacts cell morphology through its effects on peptidoglycan synthesis. Research in related bacteria demonstrates that UppP depletion leads to:

  • Elongated cell morphology due to impaired cell division

  • Irregular cell shapes indicating peptidoglycan synthesis defects

  • Potential formation of abnormal septa

In severe UppP depletion scenarios, particularly when combined with other phosphatase deficiencies, cells may exhibit more dramatic morphological abnormalities. These effects result from UP shortage, which restricts peptidoglycan precursor availability and disrupts the coordinated synthesis required for normal cell shape maintenance. Additionally, UppP depletion in spore-forming bacteria severely impairs sporulation efficiency, suggesting an essential role in developmental processes requiring intensive cell wall remodeling .

How does UppP interact with other enzymes in the cell wall synthesis pathway?

UppP functions within a complex network of enzymes involved in cell wall synthesis. Key interactions include:

  • Functional redundancy with BcrC: Both enzymes catalyze UPP dephosphorylation but likely operate under different regulatory controls.

  • Metabolic coupling with UppS: UppS (UPP synthase) generates the UPP substrate for UppP, creating a direct metabolic linkage.

  • Interplay with DgkA: The undecaprenol kinase DgkA generates UP through an alternative route by phosphorylating undecaprenol, potentially compensating for UppP deficiency.

  • Competition with bacitracin: Antibiotics like bacitracin compete for UPP binding, affecting UppP substrate availability.

  • Connection to lipid II synthetic enzymes: UppP activity ensures continuous supply of UP carrier for subsequent steps in cell wall precursor synthesis.

These interactions form a network of dependencies where UppP activity can become rate-limiting under certain conditions. Experimentally, these interactions can be studied through genetic approaches (depletion of multiple enzymes), biochemical analyses (competition assays), and stress response monitoring (using reporter constructs like P* promoter activity) .

What are the most promising approaches for studying UppP structure-function relationships?

Advanced approaches for elucidating UppP structure-function relationships include:

  • Cryo-electron microscopy: Providing high-resolution structural information of UppP in membrane environments.

  • Site-directed mutagenesis: Systematically altering conserved residues to identify catalytic and regulatory sites.

  • Molecular dynamics simulations: Modeling UppP interactions with membrane lipids and substrates.

  • Crosslinking studies: Identifying interaction partners and conformational changes during catalysis.

  • Chimeric protein analysis: Creating hybrid proteins between UppP homologs to map functional domains.

These approaches could help resolve key questions about UppP catalytic mechanism, membrane topology, and substrate recognition. The challenge remains in obtaining sufficient quantities of properly folded protein for structural studies while maintaining the native membrane environment necessary for function .

How might UppP regulation differ between commensal and pathogenic bacteria?

UppP regulation likely differs between commensal bacteria like Bifidobacterium and pathogenic species in several ways:

  • Environmental responsiveness: Commensal bacteria may have UppP regulation tailored to stable mutualistic environments, while pathogens may show more dynamic regulation responding to host defenses.

  • Stress response integration: UppP in pathogens might be more tightly integrated with virulence-associated stress responses.

  • Antibiotic resistance mechanisms: Pathogenic species may have evolved UppP regulatory systems that respond more readily to antibiotic exposure.

  • Metabolic integration: UppP activity in commensals like Bifidobacterium might be coordinated with fermentation pathways specific to intestinal environments.

  • Host interaction: Pathogens may modulate UppP activity in response to host immune factors that target cell wall synthesis.

Comparing UppP regulation between B. adolescentis and pathogenic species could reveal fundamental differences in cell wall homeostasis mechanisms between commensal and virulent bacteria, potentially identifying targets for narrow-spectrum antimicrobials .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.