Bifidobacterium adolescentis is a Gram-positive, non-motile, anaerobic bacterium that constitutes a significant portion of the human gut microbiota. B. adolescentis is one of the predominant bifidobacterial species found in the intestinal tracts of healthy adults, alongside Bifidobacterium longum . This bacterium forms a true symbiotic relationship with its human host, maintaining a non-inflammatory presence in healthy individuals while demonstrating significant immunomodulatory properties during diseased states .
The genome of B. adolescentis averages approximately 2.1 Mbp in length, containing one circular chromosome . This genomic material encodes a variety of proteins that contribute to the bacterium's functional properties, including membrane proteins that facilitate interaction with the environment and maintain cellular homeostasis.
The BAD_1445 gene is located on the chromosome of Bifidobacterium adolescentis at position NC_008618.1 (1820626..1821192) . This gene encodes the UPF0059 membrane protein, which consists of 188 amino acids with the following sequence:
MLIQILLIGVSVS MDTFAVSIGKGLTVKKLRGLDALKTALWFGGFQALFPLLGYFAASTFSKYV TAVDHWIIFGLLALIGG NMVREAFEEDE ENAKETPEFDWKHMLPLAVACSIDAVAVGVSFAFMTLNIWLSVVIIGITTGLFSAAGLYIGRVFGSRWQKPAQIAGGVVLILIGLKVLFEHLGFLG
The protein, with a calculated molecular weight of 20,329 Da, exhibits multiple hydrophobic regions characteristic of membrane proteins, consistent with its classification as a multi-pass transmembrane protein .
According to UniProt annotations, the BAD_1445 protein likely functions as a manganese efflux pump . This function is critical for maintaining appropriate intracellular manganese concentrations in bacterial cells. Manganese ions serve as essential cofactors for various enzymes but can become toxic at excessive levels, necessitating regulated transport mechanisms.
BAD_1445 is localized to the cell membrane of Bifidobacterium adolescentis, consistent with its role in transmembrane transport . The protein likely adopts a specific orientation within the membrane that facilitates the directional transport of manganese ions from the cytoplasm to the extracellular environment.
Table 2: Functional Properties of BAD_1445
| Property | Description |
|---|---|
| Primary Function | Putative manganese efflux pump |
| Substrate Specificity | Manganese ions (Mn²⁺) |
| Transport Direction | Efflux (from cytoplasm to extracellular space) |
| Cellular Localization | Cell membrane; multi-pass membrane protein |
| Known Regulators | Not specified in current research |
| Functional Family | MntP (TC 9.B.29) family |
Recombinant BAD_1445 protein can be produced in various expression systems, providing flexibility for different research applications. The available expression hosts include:
The recombinant protein typically includes tag sequences to facilitate detection and purification. These tags may be positioned at the N-terminus, C-terminus, or both, depending on the specific experimental requirements and protein characteristics .
The recombinant BAD_1445 protein can be purified to achieve a purity level of 85% or higher, as determined by SDS-PAGE analysis . While specific purification protocols are not detailed in the available research, standard methods for membrane protein purification likely involve detergent solubilization and affinity chromatography based on the incorporated tags.
Quality control measures for the recombinant protein may include:
Purity assessment by SDS-PAGE
Sterile filtration (available upon request)
BAD_1445 can serve as a model for comparative analysis with other membrane transport proteins, particularly those involved in metal ion homeostasis. Such comparisons may reveal conserved structural motifs and functional mechanisms across different bacterial species.
While specific applications of BAD_1445 are not directly addressed in the current research, its function as a manganese efflux pump suggests potential applications in:
Development of metal ion biosensors
Bioremediation strategies for metal-contaminated environments
Engineering of bacteria with enhanced metal tolerance
Design of novel antimicrobial agents targeting bacterial metal homeostasis
Table 4: Research Applications of Recombinant BAD_1445
| Application Category | Specific Applications |
|---|---|
| Basic Research | Structural studies, transport mechanism investigations, protein-metal interaction analysis |
| Comparative Biology | Evolutionary analysis of metal transport systems, comparative genomics |
| Biotechnology | Metal biosensors, engineered microorganisms, bioremediation |
| Pharmaceutical Research | Drug target identification, novel antimicrobial strategies |
While not directly linked in current research, the metal homeostasis function of BAD_1445 may indirectly contribute to the probiotic properties of B. adolescentis. The broader literature indicates that B. adolescentis exhibits significant immunomodulatory properties, particularly in inflammatory conditions . The ability to maintain appropriate metal ion concentrations could be one factor contributing to the bacterium's survival and function in the gut environment.
Despite the available information on BAD_1445, several aspects of this protein remain to be fully characterized:
Future research on BAD_1445 could focus on:
Structural determination using techniques such as X-ray crystallography or cryo-electron microscopy
Transport assays to confirm and characterize manganese efflux activity
Mutagenesis studies to identify critical functional residues
Expression analysis under various environmental conditions
Knockout or knockdown studies to assess the physiological importance of BAD_1445
Exploration of potential biotechnological applications
Table 5: Current Research Status of BAD_1445
| Aspect | Status |
|---|---|
| Gene Identification | Completed |
| Protein Sequence | Known |
| Structural Characterization | Limited; predicted to be a multi-pass membrane protein |
| Functional Annotation | Putative manganese efflux pump based on homology |
| Recombinant Production | Protocols established for research use |
| Detailed Mechanism | Not fully characterized |
| Role in B. adolescentis Physiology | Not fully characterized |
| Applications | Potential applications identified but not fully developed |
KEGG: bad:BAD_1445
STRING: 367928.BAD_1445
Bifidobacterium adolescentis is an anaerobic, mesophilic, Gram-positive bacterium typically isolated from the intestines of adults. It possesses a rod-shaped morphology and has been extensively studied for its potential probiotic properties. As a member of the Bifidobacterium genus, it displays specific growth requirements including anaerobic conditions and mesophilic temperature ranges . The bacterium has been fully sequenced, which enables the identification and study of specific proteins like BAD_1445. Importantly, B. adolescentis demonstrates physiological adaptations to the gut environment, with notable differences in membrane characteristics compared to related species such as B. longum .
The UPF0059 membrane protein BAD_1445 from B. adolescentis belongs to a class of uncharacterized protein families (UPF) associated with membrane structures. While the exact function remains under investigation, structural analysis suggests potential roles in membrane integrity, transport mechanisms, or signaling pathways. Unlike well-characterized membrane proteins, UPF0059 family members lack conclusive functional annotation, making them important targets for research aimed at expanding our understanding of bacterial membrane biology. The recombinant expression of this protein allows for detailed structural and functional studies that would otherwise be difficult with native expression levels.
Recombinant expression of membrane proteins, including BAD_1445, presents significant challenges due to their hydrophobic nature and complex folding requirements. As documented in membrane protein production studies, these proteins often cannot be produced in a reliable manner for structural analysis, forcing researchers to rely on trial-and-error approaches that frequently yield insufficient amounts . The production of membrane proteins is widely recognized as a primary bottleneck in contemporary structural genomics programs, necessitating careful optimization of expression systems, growth conditions, and purification protocols. The amphipathic nature of membrane proteins requires specialized approaches to maintain proper folding and functionality during expression and purification processes.
When designing expression systems for BAD_1445 production, researchers must consider several factors specific to membrane proteins from anaerobic bacteria. While E. coli remains a common first-choice expression host due to its rapid growth and established genetic tools, specialized strains optimized for membrane protein expression often yield better results. For membrane proteins from B. adolescentis, it's crucial to recognize that expression conditions significantly impact yields and protein quality.
Research data suggests that growth phase at harvest is critical, as demonstrated in similar membrane protein expression studies. Cells should be grown under tightly-controlled conditions and harvested prior to nutrient exhaustion, just before metabolic shifts occur . The following table summarizes key considerations for different expression systems:
| Expression System | Advantages | Disadvantages | Optimization Notes |
|---|---|---|---|
| E. coli | Fast growth, simple genetics | Membrane composition different from B. adolescentis | Use strains like C41(DE3), C43(DE3), or Lemo21(DE3) |
| Yeast systems | Eukaryotic membranes, post-translational capacity | Slower growth than bacteria | Harvest before diauxic shift, controlled growth parameters |
| Cell-free systems | Avoids toxicity issues | Lower yields, expensive | Add liposomes or nanodiscs to support membrane protein folding |
| B. adolescentis homologous | Native environment | Challenging transformation, slower growth | Requires strict anaerobic conditions, specialized media |
The selection of expression system should be guided by the downstream applications and the specific requirements for protein structure and function analysis.
The optimization of growth conditions is critical for successful BAD_1445 expression. Research on membrane protein production has shown that the most rapid growth conditions are not necessarily optimal for protein production . When expressing membrane proteins in systems like yeast, it's crucial to use high-performance bioreactors under tightly-defined growth regimes to control parameters such as oxygen levels, pH, and nutrient availability.
A methodological approach to optimization includes:
Start with small-scale expression trials using multiple expression vectors with different promoters (constitutive vs. inducible)
Test various induction conditions (inducer concentration, temperature, and timing)
Monitor growth curves carefully and determine optimal harvest points
Evaluate membrane fraction quality through western blotting and activity assays
For B. adolescentis proteins, researchers should pay particular attention to redox conditions and membrane potential, as these factors significantly influence protein folding and stability. Studies with Bifidobacterium strains have shown that environmental conditions can dramatically alter membrane properties and protein expression profiles .
Purification of membrane proteins requires specialized approaches to maintain protein stability and function. For BAD_1445, a methodical purification strategy should include:
Careful membrane isolation using differential centrifugation
Solubilization screening with multiple detergents at various concentrations
Affinity chromatography leveraging fusion tags (His, FLAG, etc.)
Size exclusion chromatography for final polishing and buffer exchange
The choice of detergent is particularly critical, as it must effectively solubilize the protein while maintaining its native conformation. A systematic screening approach using different detergent classes (maltoside, glucoside, fos-choline, etc.) at varying concentrations is recommended.
Researchers should monitor protein quality throughout purification using techniques such as analytical SEC, dynamic light scattering, and functional assays where possible. For structural studies, detergent exchange to more suitable options for crystallization or cryo-EM may be necessary in the final purification steps.
The membrane environment critically influences the structure and function of BAD_1445, as demonstrated by research on other Bifidobacterium membrane proteins. Studies have shown that Bifidobacterium adolescentis exhibits significant changes in membrane potential when exposed to different environmental conditions, including the presence of eukaryotic cells, inflammatory states, and different culture media . These findings suggest that the lipid composition and physical properties of the membrane directly impact membrane protein behavior.
When studying BAD_1445, researchers should consider reconstitution into model membrane systems that approximate the native environment. This includes consideration of:
Lipid composition (phospholipid types, cholesterol content)
Membrane fluidity and thickness
Presence of other membrane components
pH and ionic strength of surrounding solution
Functional assays should be designed to assess protein activity under conditions that mimic the intestinal environment, including variations in pH, oxygen levels, and the presence of host cell factors. This approach provides more physiologically relevant data than studies conducted in detergent solutions alone.
Understanding the regulatory mechanisms controlling BAD_1445 expression provides valuable insights for recombinant production strategies. While specific data on BAD_1445 regulation is limited, research on B. adolescentis has shown that membrane protein expression is influenced by multiple factors including growth phase, nutrient availability, and environmental stressors.
Interestingly, studies have demonstrated that changes in membrane protein yields under different culture conditions are not always reflected in corresponding changes in mRNA levels, suggesting post-transcriptional regulatory mechanisms . For BAD_1445, researchers should investigate:
Promoter elements and transcription factor binding sites
Post-transcriptional regulation via small RNAs
Translational efficiency factors
Protein stability and turnover mechanisms
These regulatory insights can inform the design of expression systems with optimized genetic elements for enhanced production of functional protein.
Structural characterization of membrane proteins presents unique challenges that require specialized approaches. For BAD_1445, researchers should consider multiple complementary techniques:
X-ray crystallography: Requires high-purity, homogeneous protein samples and often relies on protein engineering (e.g., fusion partners, thermostabilizing mutations) to facilitate crystallization
Cryo-electron microscopy: Increasingly powerful for membrane proteins, allowing visualization in more native-like environments
Nuclear magnetic resonance (NMR): Useful for dynamic studies and mapping interaction surfaces
Hydrogen-deuterium exchange mass spectrometry: Provides insights into protein dynamics and solvent accessibility
Each technique requires specific sample preparation considerations. For example, crystallography typically requires detergent screening and vapor diffusion optimization, while cryo-EM may benefit from reconstitution into nanodiscs or amphipols. A multi-technique approach often yields the most comprehensive structural insights.
Research involving recombinant proteins from B. adolescentis must adhere to institutional and national biosafety guidelines. According to standard practices for recombinant DNA research, work with B. adolescentis typically falls under Biosafety Level 1 (BSL-1) or BSL-2, depending on the specific modifications and experimental context .
Key regulatory considerations include:
Institutional Biosafety Council (IBC) review and approval of research protocols
Proper containment mechanisms including physical barriers (laboratory design), biological barriers (host-vector systems), and procedural barriers (laboratory practices)
Appropriate training for all personnel in good microbiological techniques
Proper documentation and reporting procedures
For recombinant membrane proteins like BAD_1445, additional considerations may apply if the protein is expected to alter bacterial characteristics or if expression vectors include antibiotic resistance markers. Researchers must follow institutional protocols for continuing review and report any unanticipated problems that arise involving risk .
Proper documentation of experiments involving recombinant BAD_1445 is essential for publication and reproducibility. Following established scientific reporting guidelines, researchers should:
Provide complete methods with sufficient detail to allow reproduction
Present data using a mixture of text, tables, and graphics without redundancy
Begin with general information (e.g., expression yields, purification efficiency) before presenting specific findings
Use past tense when describing results
Present statistical analyses appropriate to the experimental design
For membrane protein research, critical details to document include:
Complete sequence information including any tags or modifications
Detailed expression conditions (strain, media, temperature, induction parameters)
Precise purification protocols including buffer compositions
Quality control metrics (purity assessment, activity measurements)
Storage conditions and stability data
When presenting yield data, a clear tabular format is often most effective:
| Expression Condition | Cell Density (OD600) | Expression Level (mg/L) | Functional Protein (%) |
|---|---|---|---|
| 37°C, 0.5 mM IPTG | 2.3 ± 0.2 | 0.8 ± 0.3 | 35 ± 8 |
| 30°C, 0.1 mM IPTG | 3.1 ± 0.3 | 1.5 ± 0.4 | 62 ± 10 |
| 18°C, 0.1 mM IPTG | 2.7 ± 0.2 | 2.3 ± 0.5 | 78 ± 7 |
| Auto-induction, 25°C | 4.2 ± 0.4 | 3.1 ± 0.6 | 81 ± 9 |
This approach to documentation ensures that other researchers can build upon the findings and advances the collective understanding of membrane proteins from probiotic bacteria.
Designing functional assays for membrane proteins with unknown or poorly characterized functions presents a significant challenge. For BAD_1445, researchers should implement a multi-faceted approach that combines computational predictions with experimental validation. Potential functional assays might include:
Membrane integrity assessment in reconstituted systems
Transport assays using fluorescent substrates if BAD_1445 is predicted to have transporter activity
Protein-protein interaction studies to identify binding partners
Phenotypic analysis of knockout and overexpression strains
When designing these assays, researchers should consider environmental factors known to affect Bifidobacterium physiology, such as anaerobic conditions, pH values mimicking the intestinal environment, and the presence of host cell factors. Studies have shown that Bifidobacterium strains exhibit significant changes in membrane potential and redox activity when exposed to different environmental conditions , suggesting that similar considerations would be important for BAD_1445 functional studies.
Quality assessment of purified membrane proteins requires specialized analytical techniques. For BAD_1445, a comprehensive quality control regimen should include:
Purity assessment:
SDS-PAGE with both Coomassie and silver staining
Size exclusion chromatography with multi-angle light scattering (SEC-MALS)
Analytical ultracentrifugation
Structural integrity evaluation:
Circular dichroism (CD) spectroscopy for secondary structure analysis
Fluorescence spectroscopy for tertiary structure assessment
Thermal stability assays (differential scanning fluorimetry)
Homogeneity analysis:
Dynamic light scattering
Negative-stain electron microscopy
Native PAGE
The quality assessment data should be systematically recorded and presented in publications, as shown in this example format:
| Quality Parameter | Method | Result | Acceptance Criteria |
|---|---|---|---|
| Purity | SDS-PAGE | >95% | >90% |
| Monodispersity | SEC-MALS | 90% monomer | >85% monomer |
| Secondary structure | CD spectroscopy | 45% α-helix, 15% β-sheet | Consistent with prediction |
| Thermal stability | DSF | Tm = 58°C | >50°C |
| Homogeneity | DLS | PDI = 0.12 | PDI < 0.2 |
These analytical techniques provide crucial information for troubleshooting expression and purification protocols, as well as ensuring sample quality for downstream structural and functional studies.
Low expression yields are a common challenge when working with membrane proteins like BAD_1445. Based on experimental data from similar membrane protein studies, several systematic approaches can improve expression:
Optimize expression constructs:
Test multiple fusion tags (N-terminal, C-terminal, or both)
Remove predicted disordered regions that may interfere with folding
Codon-optimize the sequence for the expression host
Include solubility-enhancing partners (MBP, SUMO, etc.)
Refine growth conditions:
Lower induction temperature (18-25°C) to slow protein production and improve folding
Adjust inducer concentration to prevent overwhelming the membrane insertion machinery
Supplement media with specific lipids or membrane-stabilizing compounds
Harvest cells at precise growth phases before metabolic shifts occur
Consider alternative expression systems:
Test eukaryotic hosts for complex membrane proteins
Evaluate cell-free systems supplemented with lipids or nanodiscs
Explore specialized bacterial strains engineered for membrane protein expression
Research has demonstrated that the growth phase at which cells are harvested is particularly critical, with optimal results often achieved by harvesting cells just before the diauxic shift in glucose metabolism . This timing consideration can dramatically improve functional protein yields.
Protein aggregation represents a significant challenge in membrane protein purification. For BAD_1445, researchers can employ several evidence-based strategies to minimize aggregation:
Detergent optimization:
Conduct systematic screening of detergent types and concentrations
Consider mild detergents like DDM, LMNG, or GDN that have proven successful with other membrane proteins
Test mixed detergent systems that combine properties of different surfactants
Buffer optimization:
Evaluate various pH values around the theoretical pI of BAD_1445
Test stabilizing additives (glycerol, specific lipids, cholesterol)
Include specific ions that may be required for structural stability
Purification process refinements:
Maintain consistently cold temperatures throughout purification
Minimize concentration steps that can promote aggregation
Consider on-column folding strategies for proteins expressed in inclusion bodies
Alternative solubilization approaches:
Evaluate styrene-maleic acid copolymer (SMA) for native lipid co-extraction
Test amphipathic polymers like amphipols for detergent replacement
Consider nanodiscs for a more native-like membrane environment
Successful purification often requires empirical optimization, and researchers should document the effects of each variable tested to develop an effective purification protocol.
Comparative genomics approaches offer valuable insights into potential functions of uncharacterized proteins like BAD_1445. By analyzing homologs across bacterial species, researchers can identify conserved domains, genetic context, and co-evolution patterns that suggest functional roles. Key methodological approaches include:
Sequence-based homology searches across diverse bacterial genomes
Analysis of gene neighborhood conservation to identify functional associations
Examination of co-expression patterns with genes of known function
Identification of conserved protein domains and motifs
While avoiding commercial aspects, there are significant scientific applications for recombinant BAD_1445 in fundamental research and potential biotechnological contexts. These applications may include:
Structural biology platforms:
Using BAD_1445 as a model system for developing improved membrane protein crystallization techniques
Testing novel membrane mimetics for structural studies
Advancing computational prediction methods for membrane protein structures
Synthetic biology approaches:
Engineering probiotics with modified membrane properties
Developing bacterial biosensors based on membrane protein functions
Creating model systems to study host-microbe membrane interactions
Fundamental research applications:
Investigating evolutionary conservation of membrane proteins across Bifidobacterium species
Understanding adaptation mechanisms of probiotics to the gut environment
Elucidating signaling pathways in beneficial gut bacteria
These research directions highlight the scientific value of studying BAD_1445 beyond commercial applications, focusing on contributions to fundamental knowledge and methodological advances in membrane protein research.