Recombinant Bifidobacterium adolescentis UPF0059 membrane protein BAD_1445 (BAD_1445)

Shipped with Ice Packs
In Stock

Description

Introduction to Bifidobacterium adolescentis

Bifidobacterium adolescentis is a Gram-positive, non-motile, anaerobic bacterium that constitutes a significant portion of the human gut microbiota. B. adolescentis is one of the predominant bifidobacterial species found in the intestinal tracts of healthy adults, alongside Bifidobacterium longum . This bacterium forms a true symbiotic relationship with its human host, maintaining a non-inflammatory presence in healthy individuals while demonstrating significant immunomodulatory properties during diseased states .

The genome of B. adolescentis averages approximately 2.1 Mbp in length, containing one circular chromosome . This genomic material encodes a variety of proteins that contribute to the bacterium's functional properties, including membrane proteins that facilitate interaction with the environment and maintain cellular homeostasis.

Genetic Information and Protein Structure

The BAD_1445 gene is located on the chromosome of Bifidobacterium adolescentis at position NC_008618.1 (1820626..1821192) . This gene encodes the UPF0059 membrane protein, which consists of 188 amino acids with the following sequence:

MLIQILLIGVSVS MDTFAVSIGKGLTVKKLRGLDALKTALWFGGFQALFPLLGYFAASTFSKYV TAVDHWIIFGLLALIGG NMVREAFEEDE ENAKETPEFDWKHMLPLAVACSIDAVAVGVSFAFMTLNIWLSVVIIGITTGLFSAAGLYIGRVFGSRWQKPAQIAGGVVLILIGLKVLFEHLGFLG

The protein, with a calculated molecular weight of 20,329 Da, exhibits multiple hydrophobic regions characteristic of membrane proteins, consistent with its classification as a multi-pass transmembrane protein .

Primary Function as Manganese Efflux Pump

According to UniProt annotations, the BAD_1445 protein likely functions as a manganese efflux pump . This function is critical for maintaining appropriate intracellular manganese concentrations in bacterial cells. Manganese ions serve as essential cofactors for various enzymes but can become toxic at excessive levels, necessitating regulated transport mechanisms.

Cellular Localization and Orientation

BAD_1445 is localized to the cell membrane of Bifidobacterium adolescentis, consistent with its role in transmembrane transport . The protein likely adopts a specific orientation within the membrane that facilitates the directional transport of manganese ions from the cytoplasm to the extracellular environment.

Table 2: Functional Properties of BAD_1445

PropertyDescription
Primary FunctionPutative manganese efflux pump
Substrate SpecificityManganese ions (Mn²⁺)
Transport DirectionEfflux (from cytoplasm to extracellular space)
Cellular LocalizationCell membrane; multi-pass membrane protein
Known RegulatorsNot specified in current research
Functional FamilyMntP (TC 9.B.29) family

Expression Systems and Constructs

Recombinant BAD_1445 protein can be produced in various expression systems, providing flexibility for different research applications. The available expression hosts include:

  • Escherichia coli

  • Yeast

  • Baculovirus-infected insect cells

  • Mammalian cell cultures

The recombinant protein typically includes tag sequences to facilitate detection and purification. These tags may be positioned at the N-terminus, C-terminus, or both, depending on the specific experimental requirements and protein characteristics .

Purification and Quality Control

The recombinant BAD_1445 protein can be purified to achieve a purity level of 85% or higher, as determined by SDS-PAGE analysis . While specific purification protocols are not detailed in the available research, standard methods for membrane protein purification likely involve detergent solubilization and affinity chromatography based on the incorporated tags.

Quality control measures for the recombinant protein may include:

  • Purity assessment by SDS-PAGE

  • Sterile filtration (available upon request)

  • Endotoxin testing (low endotoxin preparations available)

Comparative Protein Analysis

BAD_1445 can serve as a model for comparative analysis with other membrane transport proteins, particularly those involved in metal ion homeostasis. Such comparisons may reveal conserved structural motifs and functional mechanisms across different bacterial species.

Potential Biotechnological Applications

While specific applications of BAD_1445 are not directly addressed in the current research, its function as a manganese efflux pump suggests potential applications in:

  • Development of metal ion biosensors

  • Bioremediation strategies for metal-contaminated environments

  • Engineering of bacteria with enhanced metal tolerance

  • Design of novel antimicrobial agents targeting bacterial metal homeostasis

Table 4: Research Applications of Recombinant BAD_1445

Application CategorySpecific Applications
Basic ResearchStructural studies, transport mechanism investigations, protein-metal interaction analysis
Comparative BiologyEvolutionary analysis of metal transport systems, comparative genomics
BiotechnologyMetal biosensors, engineered microorganisms, bioremediation
Pharmaceutical ResearchDrug target identification, novel antimicrobial strategies

Potential Connection to Probiotic Properties

While not directly linked in current research, the metal homeostasis function of BAD_1445 may indirectly contribute to the probiotic properties of B. adolescentis. The broader literature indicates that B. adolescentis exhibits significant immunomodulatory properties, particularly in inflammatory conditions . The ability to maintain appropriate metal ion concentrations could be one factor contributing to the bacterium's survival and function in the gut environment.

Knowledge Gaps

Despite the available information on BAD_1445, several aspects of this protein remain to be fully characterized:

Future Research Opportunities

Future research on BAD_1445 could focus on:

  • Structural determination using techniques such as X-ray crystallography or cryo-electron microscopy

  • Transport assays to confirm and characterize manganese efflux activity

  • Mutagenesis studies to identify critical functional residues

  • Expression analysis under various environmental conditions

  • Knockout or knockdown studies to assess the physiological importance of BAD_1445

  • Exploration of potential biotechnological applications

Table 5: Current Research Status of BAD_1445

AspectStatus
Gene IdentificationCompleted
Protein SequenceKnown
Structural CharacterizationLimited; predicted to be a multi-pass membrane protein
Functional AnnotationPutative manganese efflux pump based on homology
Recombinant ProductionProtocols established for research use
Detailed MechanismNot fully characterized
Role in B. adolescentis PhysiologyNot fully characterized
ApplicationsPotential applications identified but not fully developed

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution. Storage at -20°C/-80°C is recommended. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; BAD_1445; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Target Names
mntP
Target Protein Sequence
MLIQILLIGVSVSMDTFAVSIGKGLTVKKLRGLDALKTALWFGGFQALFPLLGYFAASTF SKYVTAVDHWIIFGLLALIGGNMVREAFEEDEENAKETPEFDWKHMLPLAVACSIDAVAV GVSFAFMTLNIWLSVVIIGITTGLFSAAGLYIGRVFGSRWQKPAQIAGGVVLILIGLKVL FEHLGFLG
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bifidobacterium adolescentis and what are its key characteristics?

Bifidobacterium adolescentis is an anaerobic, mesophilic, Gram-positive bacterium typically isolated from the intestines of adults. It possesses a rod-shaped morphology and has been extensively studied for its potential probiotic properties. As a member of the Bifidobacterium genus, it displays specific growth requirements including anaerobic conditions and mesophilic temperature ranges . The bacterium has been fully sequenced, which enables the identification and study of specific proteins like BAD_1445. Importantly, B. adolescentis demonstrates physiological adaptations to the gut environment, with notable differences in membrane characteristics compared to related species such as B. longum .

What is the UPF0059 membrane protein BAD_1445 and what is its predicted function?

The UPF0059 membrane protein BAD_1445 from B. adolescentis belongs to a class of uncharacterized protein families (UPF) associated with membrane structures. While the exact function remains under investigation, structural analysis suggests potential roles in membrane integrity, transport mechanisms, or signaling pathways. Unlike well-characterized membrane proteins, UPF0059 family members lack conclusive functional annotation, making them important targets for research aimed at expanding our understanding of bacterial membrane biology. The recombinant expression of this protein allows for detailed structural and functional studies that would otherwise be difficult with native expression levels.

Why is recombinant expression of membrane proteins particularly challenging?

Recombinant expression of membrane proteins, including BAD_1445, presents significant challenges due to their hydrophobic nature and complex folding requirements. As documented in membrane protein production studies, these proteins often cannot be produced in a reliable manner for structural analysis, forcing researchers to rely on trial-and-error approaches that frequently yield insufficient amounts . The production of membrane proteins is widely recognized as a primary bottleneck in contemporary structural genomics programs, necessitating careful optimization of expression systems, growth conditions, and purification protocols. The amphipathic nature of membrane proteins requires specialized approaches to maintain proper folding and functionality during expression and purification processes.

What expression systems are most suitable for recombinant BAD_1445 production?

When designing expression systems for BAD_1445 production, researchers must consider several factors specific to membrane proteins from anaerobic bacteria. While E. coli remains a common first-choice expression host due to its rapid growth and established genetic tools, specialized strains optimized for membrane protein expression often yield better results. For membrane proteins from B. adolescentis, it's crucial to recognize that expression conditions significantly impact yields and protein quality.

Research data suggests that growth phase at harvest is critical, as demonstrated in similar membrane protein expression studies. Cells should be grown under tightly-controlled conditions and harvested prior to nutrient exhaustion, just before metabolic shifts occur . The following table summarizes key considerations for different expression systems:

Expression SystemAdvantagesDisadvantagesOptimization Notes
E. coliFast growth, simple geneticsMembrane composition different from B. adolescentisUse strains like C41(DE3), C43(DE3), or Lemo21(DE3)
Yeast systemsEukaryotic membranes, post-translational capacitySlower growth than bacteriaHarvest before diauxic shift, controlled growth parameters
Cell-free systemsAvoids toxicity issuesLower yields, expensiveAdd liposomes or nanodiscs to support membrane protein folding
B. adolescentis homologousNative environmentChallenging transformation, slower growthRequires strict anaerobic conditions, specialized media

The selection of expression system should be guided by the downstream applications and the specific requirements for protein structure and function analysis.

How should researchers optimize growth conditions for maximum BAD_1445 expression?

The optimization of growth conditions is critical for successful BAD_1445 expression. Research on membrane protein production has shown that the most rapid growth conditions are not necessarily optimal for protein production . When expressing membrane proteins in systems like yeast, it's crucial to use high-performance bioreactors under tightly-defined growth regimes to control parameters such as oxygen levels, pH, and nutrient availability.

A methodological approach to optimization includes:

  • Start with small-scale expression trials using multiple expression vectors with different promoters (constitutive vs. inducible)

  • Test various induction conditions (inducer concentration, temperature, and timing)

  • Monitor growth curves carefully and determine optimal harvest points

  • Evaluate membrane fraction quality through western blotting and activity assays

For B. adolescentis proteins, researchers should pay particular attention to redox conditions and membrane potential, as these factors significantly influence protein folding and stability. Studies with Bifidobacterium strains have shown that environmental conditions can dramatically alter membrane properties and protein expression profiles .

What purification strategies are most effective for isolating recombinant BAD_1445?

Purification of membrane proteins requires specialized approaches to maintain protein stability and function. For BAD_1445, a methodical purification strategy should include:

  • Careful membrane isolation using differential centrifugation

  • Solubilization screening with multiple detergents at various concentrations

  • Affinity chromatography leveraging fusion tags (His, FLAG, etc.)

  • Size exclusion chromatography for final polishing and buffer exchange

The choice of detergent is particularly critical, as it must effectively solubilize the protein while maintaining its native conformation. A systematic screening approach using different detergent classes (maltoside, glucoside, fos-choline, etc.) at varying concentrations is recommended.

Researchers should monitor protein quality throughout purification using techniques such as analytical SEC, dynamic light scattering, and functional assays where possible. For structural studies, detergent exchange to more suitable options for crystallization or cryo-EM may be necessary in the final purification steps.

How does the membrane environment affect BAD_1445 structure and function?

The membrane environment critically influences the structure and function of BAD_1445, as demonstrated by research on other Bifidobacterium membrane proteins. Studies have shown that Bifidobacterium adolescentis exhibits significant changes in membrane potential when exposed to different environmental conditions, including the presence of eukaryotic cells, inflammatory states, and different culture media . These findings suggest that the lipid composition and physical properties of the membrane directly impact membrane protein behavior.

When studying BAD_1445, researchers should consider reconstitution into model membrane systems that approximate the native environment. This includes consideration of:

  • Lipid composition (phospholipid types, cholesterol content)

  • Membrane fluidity and thickness

  • Presence of other membrane components

  • pH and ionic strength of surrounding solution

Functional assays should be designed to assess protein activity under conditions that mimic the intestinal environment, including variations in pH, oxygen levels, and the presence of host cell factors. This approach provides more physiologically relevant data than studies conducted in detergent solutions alone.

What regulatory mechanisms control BAD_1445 expression in B. adolescentis?

Understanding the regulatory mechanisms controlling BAD_1445 expression provides valuable insights for recombinant production strategies. While specific data on BAD_1445 regulation is limited, research on B. adolescentis has shown that membrane protein expression is influenced by multiple factors including growth phase, nutrient availability, and environmental stressors.

Interestingly, studies have demonstrated that changes in membrane protein yields under different culture conditions are not always reflected in corresponding changes in mRNA levels, suggesting post-transcriptional regulatory mechanisms . For BAD_1445, researchers should investigate:

  • Promoter elements and transcription factor binding sites

  • Post-transcriptional regulation via small RNAs

  • Translational efficiency factors

  • Protein stability and turnover mechanisms

These regulatory insights can inform the design of expression systems with optimized genetic elements for enhanced production of functional protein.

How can structural biology techniques be applied to characterize BAD_1445?

Structural characterization of membrane proteins presents unique challenges that require specialized approaches. For BAD_1445, researchers should consider multiple complementary techniques:

  • X-ray crystallography: Requires high-purity, homogeneous protein samples and often relies on protein engineering (e.g., fusion partners, thermostabilizing mutations) to facilitate crystallization

  • Cryo-electron microscopy: Increasingly powerful for membrane proteins, allowing visualization in more native-like environments

  • Nuclear magnetic resonance (NMR): Useful for dynamic studies and mapping interaction surfaces

  • Hydrogen-deuterium exchange mass spectrometry: Provides insights into protein dynamics and solvent accessibility

Each technique requires specific sample preparation considerations. For example, crystallography typically requires detergent screening and vapor diffusion optimization, while cryo-EM may benefit from reconstitution into nanodiscs or amphipols. A multi-technique approach often yields the most comprehensive structural insights.

What biosafety requirements apply to work with recombinant B. adolescentis proteins?

Research involving recombinant proteins from B. adolescentis must adhere to institutional and national biosafety guidelines. According to standard practices for recombinant DNA research, work with B. adolescentis typically falls under Biosafety Level 1 (BSL-1) or BSL-2, depending on the specific modifications and experimental context .

Key regulatory considerations include:

  • Institutional Biosafety Council (IBC) review and approval of research protocols

  • Proper containment mechanisms including physical barriers (laboratory design), biological barriers (host-vector systems), and procedural barriers (laboratory practices)

  • Appropriate training for all personnel in good microbiological techniques

  • Proper documentation and reporting procedures

For recombinant membrane proteins like BAD_1445, additional considerations may apply if the protein is expected to alter bacterial characteristics or if expression vectors include antibiotic resistance markers. Researchers must follow institutional protocols for continuing review and report any unanticipated problems that arise involving risk .

How should researchers document recombinant BAD_1445 experiments for publication?

Proper documentation of experiments involving recombinant BAD_1445 is essential for publication and reproducibility. Following established scientific reporting guidelines, researchers should:

  • Provide complete methods with sufficient detail to allow reproduction

  • Present data using a mixture of text, tables, and graphics without redundancy

  • Begin with general information (e.g., expression yields, purification efficiency) before presenting specific findings

  • Use past tense when describing results

  • Present statistical analyses appropriate to the experimental design

For membrane protein research, critical details to document include:

  • Complete sequence information including any tags or modifications

  • Detailed expression conditions (strain, media, temperature, induction parameters)

  • Precise purification protocols including buffer compositions

  • Quality control metrics (purity assessment, activity measurements)

  • Storage conditions and stability data

When presenting yield data, a clear tabular format is often most effective:

Expression ConditionCell Density (OD600)Expression Level (mg/L)Functional Protein (%)
37°C, 0.5 mM IPTG2.3 ± 0.20.8 ± 0.335 ± 8
30°C, 0.1 mM IPTG3.1 ± 0.31.5 ± 0.462 ± 10
18°C, 0.1 mM IPTG2.7 ± 0.22.3 ± 0.578 ± 7
Auto-induction, 25°C4.2 ± 0.43.1 ± 0.681 ± 9

This approach to documentation ensures that other researchers can build upon the findings and advances the collective understanding of membrane proteins from probiotic bacteria.

How can functional assays be designed to evaluate BAD_1445 activity?

Designing functional assays for membrane proteins with unknown or poorly characterized functions presents a significant challenge. For BAD_1445, researchers should implement a multi-faceted approach that combines computational predictions with experimental validation. Potential functional assays might include:

  • Membrane integrity assessment in reconstituted systems

  • Transport assays using fluorescent substrates if BAD_1445 is predicted to have transporter activity

  • Protein-protein interaction studies to identify binding partners

  • Phenotypic analysis of knockout and overexpression strains

When designing these assays, researchers should consider environmental factors known to affect Bifidobacterium physiology, such as anaerobic conditions, pH values mimicking the intestinal environment, and the presence of host cell factors. Studies have shown that Bifidobacterium strains exhibit significant changes in membrane potential and redox activity when exposed to different environmental conditions , suggesting that similar considerations would be important for BAD_1445 functional studies.

What analytical techniques are most appropriate for quality assessment of purified BAD_1445?

Quality assessment of purified membrane proteins requires specialized analytical techniques. For BAD_1445, a comprehensive quality control regimen should include:

  • Purity assessment:

    • SDS-PAGE with both Coomassie and silver staining

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation

  • Structural integrity evaluation:

    • Circular dichroism (CD) spectroscopy for secondary structure analysis

    • Fluorescence spectroscopy for tertiary structure assessment

    • Thermal stability assays (differential scanning fluorimetry)

  • Homogeneity analysis:

    • Dynamic light scattering

    • Negative-stain electron microscopy

    • Native PAGE

The quality assessment data should be systematically recorded and presented in publications, as shown in this example format:

Quality ParameterMethodResultAcceptance Criteria
PuritySDS-PAGE>95%>90%
MonodispersitySEC-MALS90% monomer>85% monomer
Secondary structureCD spectroscopy45% α-helix, 15% β-sheetConsistent with prediction
Thermal stabilityDSFTm = 58°C>50°C
HomogeneityDLSPDI = 0.12PDI < 0.2

These analytical techniques provide crucial information for troubleshooting expression and purification protocols, as well as ensuring sample quality for downstream structural and functional studies.

How can researchers address low expression yields of recombinant BAD_1445?

Low expression yields are a common challenge when working with membrane proteins like BAD_1445. Based on experimental data from similar membrane protein studies, several systematic approaches can improve expression:

  • Optimize expression constructs:

    • Test multiple fusion tags (N-terminal, C-terminal, or both)

    • Remove predicted disordered regions that may interfere with folding

    • Codon-optimize the sequence for the expression host

    • Include solubility-enhancing partners (MBP, SUMO, etc.)

  • Refine growth conditions:

    • Lower induction temperature (18-25°C) to slow protein production and improve folding

    • Adjust inducer concentration to prevent overwhelming the membrane insertion machinery

    • Supplement media with specific lipids or membrane-stabilizing compounds

    • Harvest cells at precise growth phases before metabolic shifts occur

  • Consider alternative expression systems:

    • Test eukaryotic hosts for complex membrane proteins

    • Evaluate cell-free systems supplemented with lipids or nanodiscs

    • Explore specialized bacterial strains engineered for membrane protein expression

Research has demonstrated that the growth phase at which cells are harvested is particularly critical, with optimal results often achieved by harvesting cells just before the diauxic shift in glucose metabolism . This timing consideration can dramatically improve functional protein yields.

What strategies can overcome protein aggregation during BAD_1445 purification?

Protein aggregation represents a significant challenge in membrane protein purification. For BAD_1445, researchers can employ several evidence-based strategies to minimize aggregation:

  • Detergent optimization:

    • Conduct systematic screening of detergent types and concentrations

    • Consider mild detergents like DDM, LMNG, or GDN that have proven successful with other membrane proteins

    • Test mixed detergent systems that combine properties of different surfactants

  • Buffer optimization:

    • Evaluate various pH values around the theoretical pI of BAD_1445

    • Test stabilizing additives (glycerol, specific lipids, cholesterol)

    • Include specific ions that may be required for structural stability

  • Purification process refinements:

    • Maintain consistently cold temperatures throughout purification

    • Minimize concentration steps that can promote aggregation

    • Consider on-column folding strategies for proteins expressed in inclusion bodies

  • Alternative solubilization approaches:

    • Evaluate styrene-maleic acid copolymer (SMA) for native lipid co-extraction

    • Test amphipathic polymers like amphipols for detergent replacement

    • Consider nanodiscs for a more native-like membrane environment

Successful purification often requires empirical optimization, and researchers should document the effects of each variable tested to develop an effective purification protocol.

How might comparative genomics inform our understanding of BAD_1445 function?

Comparative genomics approaches offer valuable insights into potential functions of uncharacterized proteins like BAD_1445. By analyzing homologs across bacterial species, researchers can identify conserved domains, genetic context, and co-evolution patterns that suggest functional roles. Key methodological approaches include:

  • Sequence-based homology searches across diverse bacterial genomes

  • Analysis of gene neighborhood conservation to identify functional associations

  • Examination of co-expression patterns with genes of known function

  • Identification of conserved protein domains and motifs

What potential biotechnological applications exist for recombinant BAD_1445?

While avoiding commercial aspects, there are significant scientific applications for recombinant BAD_1445 in fundamental research and potential biotechnological contexts. These applications may include:

  • Structural biology platforms:

    • Using BAD_1445 as a model system for developing improved membrane protein crystallization techniques

    • Testing novel membrane mimetics for structural studies

    • Advancing computational prediction methods for membrane protein structures

  • Synthetic biology approaches:

    • Engineering probiotics with modified membrane properties

    • Developing bacterial biosensors based on membrane protein functions

    • Creating model systems to study host-microbe membrane interactions

  • Fundamental research applications:

    • Investigating evolutionary conservation of membrane proteins across Bifidobacterium species

    • Understanding adaptation mechanisms of probiotics to the gut environment

    • Elucidating signaling pathways in beneficial gut bacteria

These research directions highlight the scientific value of studying BAD_1445 beyond commercial applications, focusing on contributions to fundamental knowledge and methodological advances in membrane protein research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.