Recombinant Bifidobacterium animalis subsp. lactis Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant uppP

Undecaprenyl-diphosphatase (uppP), encoded by the uppP gene (locus tag: BLA_1353 in B. animalis subsp. lactis), is a membrane-associated enzyme (EC 3.6.1.27) that catalyzes the hydrolysis of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), a critical step in bacterial peptidoglycan and teichoic acid biosynthesis . Recombinant variants are typically expressed with affinity tags (e.g., His-tag) in Escherichia coli or yeast systems for purification and functional studies .

Table 1: Key properties of recombinant uppP

PropertyDetails
Species OriginBifidobacterium animalis subsp. lactis (strain AD011)
Uniprot IDB8DUF9 (native); P39438 (heterologously expressed)
Protein Length295 aa (full-length) ; 187 aa (truncated variant)
Expression HostsE. coli, yeast, baculovirus, mammalian cells
TagHis-tag, Avi-tag (biotinylated variants available)
Purity>90% (SDS-PAGE)
StorageTris/PBS buffer with glycerol; stable at -80°C

Functional Role in Bacterial Physiology

uppP is essential for recycling lipid carriers during cell wall synthesis and confers resistance to bacitracin, an antibiotic that sequesters UPP . Studies on B. animalis subsp. lactis proteomes under bile stress identified uppP as a constitutively expressed protein, suggesting its role in membrane stability and stress adaptation . Additionally, homologs in other species (e.g., Azospirillum brasilense) share conserved catalytic motifs, such as the GG(X7)G domain for pyrophosphate hydrolysis .

4.2. Biotechnological Relevance

  • Overexpression of uppP in B. animalis subsp. lactis enhances bile salt tolerance, a trait vital for probiotic survival in the gastrointestinal tract .

  • Comparative proteomics revealed upregulated uppP levels in bile-adapted strains, linking it to membrane remodeling under stress .

Future Directions

While current studies focus on uppP’s biochemical properties, its potential in synthetic biology (e.g., engineering antibiotic-resistant probiotics) remains underexplored. Further structural studies (e.g., cryo-EM) could elucidate its regulation in live bacteria .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
uppP; BLA_1353; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Bifidobacterium animalis subsp. lactis (strain AD011)
Target Names
uppP
Target Protein Sequence
MNFFQAIFLGLVQALTEYLPVSSSAHVRIVGDLMLGGDPGAAFTAIIQIGTELAVLLYFR RDIWNILKSWCLCLAGKEGKDRASRFGAHNKDARLGWYIIIATIPILIAGVLFQHAIETT LRNLWITVAMLFIFGVILWIVDDRARQVKTLDDMNTKDAIWFGIGQMLALIPGVSRSGGT ITFGRAMGYKREAAVRAAFLMAIPAVFGAGILEAVKAIKDVNADAMFPGWGATIAATVVA FVVGYIVIIGFLKFVSTYSYKAFAIYRIALAIIVAILLLCGVLSPLEGIPVSGNA
Uniprot No.

Target Background

Function
This recombinant *Bifidobacterium animalis* subsp. *lactis* Undecaprenyl-diphosphatase (UppP) catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers bacitracin resistance.
Database Links

KEGG: bla:BLA_1353

Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Undecaprenyl-diphosphatase (uppP) in Bifidobacterium animalis subsp. lactis?

Undecaprenyl-diphosphatase (uppP) in B. animalis subsp. lactis, like in other bacteria, catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, which serves as an essential carrier lipid in bacterial cell wall synthesis . This reaction is critical for the recycling of the lipid carrier molecule that transports peptidoglycan precursors across the cytoplasmic membrane. The enzyme participates in the formation of glycosylated products (Lipid I, Lipid II) that are subsequently converted to peptidoglycan cell wall components, making it fundamental to bacterial cell integrity and growth . As an integral membrane protein, uppP plays a pivotal role in maintaining cell wall biosynthesis pathways that are unique to prokaryotic organisms, which explains its significance as a potential antimicrobial target.

How does uppP differ structurally from other bacterial phosphatases?

Undecaprenyl-diphosphatase (uppP) contains distinctive structural elements that differentiate it from other bacterial phosphatases. Sequence alignment analyses reveal two highly conserved consensus regions that form the active site: glutamate-rich (E/Q)XXXE motifs and PGXSRSXXT motifs, along with a histidine residue that is critical for catalytic activity . This active site is proposed to be located in the periplasmic region of the protein.

Unlike cytoplasmic phosphatases, uppP is an integral membrane protein with multiple transmembrane domains that position it to access its lipid substrate. The enzyme's architecture includes a hydrophobic pocket designed to accommodate the long undecaprenyl chain while positioning the pyrophosphate group at the active site. The three-dimensional structure of the enzyme has been modeled using computational methods, revealing that catalytically important residues (including Glu-21, His-30, and Arg-174 in E. coli UppP) must be positioned within a 10 Å diameter sphere to form a functional active site pocket .

What are the primary experimental methods for measuring uppP enzymatic activity?

To measure uppP enzymatic activity, researchers typically employ phosphate release assays using colorimetric detection methods. A standard protocol involves:

  • Substrate preparation: Undecaprenyl pyrophosphate or analogs like farnesyl pyrophosphate (Fpp) are used as substrates .

  • Reaction conditions: The typical reaction mixture contains:

    • Buffer system (e.g., 50 mM Hepes, pH 7.0)

    • Salt (e.g., 150 mM NaCl)

    • Divalent cations (e.g., 10 mM MgCl₂)

    • Detergent to maintain protein solubility (e.g., 0.02% DDM)

    • Substrate (e.g., 0.3-57 μM Fpp)

    • Purified enzyme (20-40 nM)

  • Detection methods: The reaction is typically incubated at 37°C and then quenched with Malachite Green reagent, which forms a colored complex with the released inorganic phosphate. Absorbance is measured at 650 nm, and phosphate concentration is determined using a standard curve .

  • Kinetic parameter determination: By varying substrate concentrations, researchers can determine Michaelis-Menten kinetic parameters (Km and kcat) by fitting initial velocity data to the Michaelis-Menten equation using appropriate software .

The pH dependency of the enzyme can be assessed by conducting the assay across various pH ranges using different buffer systems (e.g., sodium acetate for pH 5-6, Hepes for pH 6.5-8, and Tris-HCl for pH 9) .

What expression systems are most effective for producing recombinant B. animalis subsp. lactis uppP?

For effective recombinant expression of B. animalis subsp. lactis uppP, researchers typically utilize specialized expression systems designed for membrane proteins. While the search results don't specifically address expression systems for B. animalis uppP, successful approaches for similar membrane phosphatases include:

  • E. coli-based expression systems: Modified strains such as C41(DE3) or C43(DE3), which are engineered for membrane protein expression, often yield better results than standard BL21(DE3) strains. Expression vectors containing T7 or tac promoters with temperature-inducible or IPTG-inducible systems provide controlled expression, which is crucial since overexpression of membrane proteins can be toxic to host cells .

  • Growth conditions optimization: Culturing at lower temperatures (16-25°C) after induction slows protein synthesis, potentially improving proper folding and membrane insertion. Media composition, particularly the carbon source and nitrogen content, significantly impacts expression levels. For B. animalis-derived proteins, medium supplementation with specific carbon sources like glucose has shown promising results in supporting robust growth .

  • Fusion tag strategies: Adding fusion partners such as maltose-binding protein (MBP), thioredoxin, or His-tags facilitates both expression and subsequent purification. For membrane proteins like uppP, C-terminal His-tags are often preferable to avoid interference with membrane insertion .

  • Codon optimization: Adjusting the codon usage to match the preferred codons of the expression host can significantly improve translation efficiency, particularly important when expressing B. animalis genes in E. coli due to different GC content and codon preferences.

For optimal results, researchers should conduct small-scale expression trials comparing multiple constructs, expression strains, induction conditions, and growth media to determine the most efficient system for their specific research needs.

What are the optimal purification strategies for maintaining the structural integrity and activity of recombinant uppP?

Purifying recombinant uppP while maintaining its structural integrity and activity requires specialized techniques for membrane proteins. An optimal purification strategy includes:

  • Membrane isolation: After cell lysis (typically via sonication, French press, or enzymatic methods), membranes containing uppP are isolated through differential centrifugation. This involves low-speed centrifugation to remove cell debris followed by ultracentrifugation (100,000-150,000 × g) to collect membrane fractions .

  • Detergent solubilization: Critical for extracting uppP from membranes, this step requires careful selection of detergents. Mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) at 0.5-2% are effective for maintaining enzyme activity. Incubation is typically performed at 4°C for 1-2 hours with gentle agitation .

  • Affinity chromatography: For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-based resins provides efficient initial purification. All buffers must contain detergent at concentrations above the critical micelle concentration (CMC) to maintain protein solubility. Typical washing buffers contain low imidazole concentrations (20-40 mM) to reduce non-specific binding, while elution is achieved with higher imidazole concentrations (250-500 mM) .

  • Size exclusion chromatography: This polishing step separates protein aggregates and improves homogeneity. Suitable columns include Superdex 200 or Superose 6, run in buffer containing detergent .

  • Stabilization conditions: Throughout purification, stability is enhanced by maintaining low temperature (4°C), including glycerol (10-20%) in buffers, and adding divalent cations like Mg²⁺ (10 mM) that serve as cofactors for enzyme activity .

The purified enzyme should be evaluated for homogeneity via SDS-PAGE and activity using phosphate release assays, with typical yields ranging from 0.5-5 mg of purified protein per liter of bacterial culture.

How can researchers verify the correct folding and membrane integration of recombinant uppP?

Verifying correct folding and membrane integration of recombinant uppP requires multiple complementary approaches:

  • Enzymatic activity assays: The most direct evidence of proper folding is demonstrating catalytic activity using the methods described in FAQ 1.3. Functional uppP should catalyze the dephosphorylation of undecaprenyl pyrophosphate with kinetic parameters comparable to the native enzyme. pH profile analysis can also provide insights into the correct folding and active site arrangement .

  • Circular dichroism (CD) spectroscopy: This technique provides information about secondary structure content. For uppP, which contains predominantly α-helical transmembrane segments, the CD spectrum should display characteristic minima at 208 and 222 nm. Thermal denaturation studies monitored by CD can assess protein stability.

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence can indicate tertiary structure integrity. Properly folded membrane proteins typically show blue-shifted emission maxima compared to unfolded states due to the hydrophobic environment of the membrane.

  • Limited proteolysis: Correctly folded membrane proteins are generally more resistant to proteolysis than misfolded variants. Time-course digestion with proteases like trypsin or chymotrypsin followed by SDS-PAGE analysis can reveal structural stability.

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS): This approach can determine whether the purified protein exists as a monomer, dimer, or higher-order oligomer in detergent micelles, providing insights into quaternary structure.

  • Reconstitution into liposomes: Functional reconstitution into artificial membrane systems represents a gold standard for verifying membrane protein functionality. Successfully reconstituted uppP should demonstrate activity levels comparable to or higher than those observed in detergent micelles.

For comprehensive validation, researchers should employ at least 2-3 of these complementary methods to ensure that recombinant uppP maintains native-like structure and function.

Which amino acid residues are critical for the catalytic activity of uppP, and how can they be experimentally identified?

Critical amino acid residues in the uppP catalytic site can be identified through several experimental approaches:

  • Sequence alignment and conservation analysis: Comparative sequence analysis reveals two highly conserved motifs in uppP: the glutamate-rich (E/Q)XXXE pattern and the PGXSRSXXT sequence. Additionally, a conserved histidine residue has been identified as essential for catalysis . This bioinformatic approach provides initial targets for mutagenesis studies.

  • Site-directed mutagenesis: Systematic replacement of conserved residues with alanine or functionally similar amino acids helps determine their contribution to catalysis. Key targets include:

    • Glutamate residues within the (E/Q)XXXE motif

    • The conserved histidine (e.g., His-30 in E. coli UppP)

    • Arginine residues (e.g., Arg-174) that may stabilize the phosphate group

    • Serine residues within the PGXSRSXXT motif that may participate in the catalytic mechanism

  • Kinetic characterization of mutants: Purified mutant enzymes should be characterized to determine changes in:

    • Substrate affinity (Km)

    • Catalytic rate (kcat)

    • pH dependence profiles

    • Metal ion requirements

    A significant reduction in kcat with minimal change in Km typically indicates a residue involved in catalysis rather than substrate binding .

  • Chemical modification studies: Site-specific chemical modifications can provide complementary evidence. For example:

    • Diethylpyrocarbonate (DEPC) to modify histidine residues

    • Carbodiimides to modify glutamate/aspartate residues

    • Phenylglyoxal to modify arginine residues

  • Structural studies with inhibitor binding: Co-crystallization or computational docking of known inhibitors like bacitracin can reveal interactions with specific residues, providing indirect evidence of their role in substrate binding or catalysis .

In E. coli UppP, residues Glu-21, His-30, and Arg-174 have been identified as critical and must be positioned within approximately 10 Å to form an effective catalytic site . Similar experimental approaches can be applied to B. animalis subsp. lactis uppP to identify its catalytically essential residues.

How does the membrane environment affect uppP activity, and what methods can be used to study this relationship?

The membrane environment significantly impacts uppP activity through multiple mechanisms. To study this relationship, researchers can employ several approaches:

  • Detergent screening: Different detergents create distinct microenvironments that affect enzyme stability and activity. Systematic comparison of uppP activity in various detergents (non-ionic like DDM, Triton X-100, or zwitterionic like CHAPSO) provides insights into optimal membrane-mimicking conditions. Activity assays should be conducted using a standardized protocol with the substrate and detection system described in FAQ 1.3, varying only the detergent type and concentration .

  • Reconstitution into liposomes: This approach more closely mimics the native membrane environment. Researchers can:

    • Create liposomes with defined lipid compositions (varying phospholipid headgroups, acyl chain lengths, and cholesterol content)

    • Incorporate purified uppP into these liposomes using detergent removal methods (dialysis, Bio-Beads, or gel filtration)

    • Measure enzyme activity in these reconstituted systems to determine how specific lipid components affect function

  • Nanodiscs technology: Nanodiscs provide a more controlled membrane environment than liposomes. uppP can be incorporated into nanodiscs with precise lipid compositions, enabling studies of lipid-protein interactions without detergent interference.

  • Fluorescence-based membrane interaction studies: Techniques like Förster resonance energy transfer (FRET) between labeled uppP and membrane probes can reveal how the enzyme interacts with and positions itself within the membrane bilayer.

  • Molecular dynamics simulations: Computational approaches can model uppP within a lipid bilayer to predict:

    • Protein orientation and depth of insertion

    • Lipid-protein interactions

    • Conformational changes influenced by the membrane environment

    • Access channels for substrate entry and product release

  • Effect of membrane curvature: Using liposomes of different sizes (from 50 nm to 400 nm in diameter) to study whether membrane curvature affects enzyme activity, potentially revealing insights about in vivo localization preferences.

These methodologies collectively provide a comprehensive understanding of how the membrane environment modulates uppP structure, dynamics, and catalytic function, which is essential for developing effective inhibition strategies and understanding the enzyme's physiological role.

What structural differences exist between uppP from B. animalis subsp. lactis and uppP from other bacterial species?

While the search results don't provide direct comparative structural information between B. animalis subsp. lactis uppP and other bacterial species' uppP enzymes, we can identify potential structural differences based on general principles of membrane protein evolution and the available information about uppP from E. coli and other bacteria:

  • Sequence variation in conserved motifs: Though all bacterial uppP enzymes contain the core (E/Q)XXXE and PGXSRSXXT motifs, B. animalis subsp. lactis uppP may show specific amino acid substitutions within and around these motifs that reflect adaptation to the unique cell envelope composition of this Gram-positive bacterium . These variations might alter substrate specificity, catalytic efficiency, or inhibitor sensitivity while maintaining the core function.

  • Transmembrane topology differences: The number and arrangement of transmembrane segments may differ between B. animalis subsp. lactis uppP and its counterparts in other bacteria. These differences could influence:

    • The positioning of the active site relative to the membrane

    • Substrate access channels

    • Interaction with other membrane components

  • Active site architecture: The positioning of the catalytic residues (glutamates, histidine, and arginine) within the three-dimensional structure may show species-specific variations that affect:

    • Substrate binding affinity

    • Catalytic rate

    • pH optimum

    • Metal ion coordination

  • Loop regions: The extramembrane loops connecting transmembrane segments often show greater sequence and structural variation than the conserved core regions. These differences may affect:

    • Enzyme stability

    • Regulatory interactions with other proteins

    • Recognition by species-specific inhibitors

  • Post-translational modifications: B. animalis subsp. lactis may employ specific post-translational modifications not present in other bacterial species that modulate uppP activity in response to environmental conditions.

To experimentally characterize these differences, researchers could:

  • Perform comparative homology modeling of B. animalis subsp. lactis uppP based on the available structural information for E. coli UppP

  • Express recombinant versions of uppP from multiple bacterial species and compare their biochemical properties

  • Conduct cross-species complementation experiments to assess functional conservation

  • Test species-specific inhibitor sensitivity profiles to identify structural differences in the active site or substrate binding pocket

These approaches would provide valuable insights into the structural adaptations of uppP across bacterial species and potentially identify unique features of the B. animalis subsp. lactis enzyme that could be exploited for selective targeting.

How can researchers design effective screening assays for identifying specific inhibitors of B. animalis subsp. lactis uppP?

Designing effective screening assays for B. animalis subsp. lactis uppP inhibitors requires robust, reproducible methodologies suitable for high-throughput applications:

  • Primary biochemical assay development:

    • Phosphate release detection: Adapt the Malachite Green assay to a microplate format for high-throughput screening. The assay should contain purified recombinant uppP, substrate (undecaprenyl pyrophosphate or a suitable analog like farnesyl pyrophosphate), appropriate buffer (e.g., 50 mM Hepes, pH 7.0), salt (150 mM NaCl), and magnesium (10 mM MgCl₂) . Optimize substrate concentration to approximately Km to identify competitive inhibitors efficiently.

    • Fluorescence-based alternatives: Develop assays using fluorescent phosphate sensors or fluorescently-labeled substrates for improved sensitivity and real-time monitoring.

  • Assay validation criteria:

    • Determine Z'-factor (typically >0.5 for robust assays)

    • Establish reproducibility across plates and days (CV <15%)

    • Include appropriate controls (known inhibitors like bacitracin at ~32 μM IC₅₀ )

    • Develop counter-screening against related phosphatases to identify selective inhibitors

  • Secondary assays for hit confirmation:

    • Dose-response analysis: Test active compounds at multiple concentrations (typically 8-12 points) to generate IC₅₀ curves

    • Mechanism of inhibition studies: Determine competitive, noncompetitive, or uncompetitive mechanisms through substrate-velocity analysis

    • Direct binding assays: Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to confirm and characterize binding interactions

  • Whole-cell activity assessment:

    • Develop growth inhibition assays using B. animalis subsp. lactis cultures in optimized medium (like medium 4 supplemented with glucose as shown effective for B. lactis HN019 )

    • Measure effects on bacterial growth metrics (lag phase, growth rate, final biomass)

    • Correlate whole-cell activity with enzyme inhibition potency to establish structure-activity relationships

  • Target engagement verification:

    • Develop resistant mutants and sequence the uppP gene to identify resistance mechanisms

    • Use cellular thermal shift assays (CETSA) to confirm inhibitor binding to uppP in intact cells

    • Measure accumulation of undecaprenyl pyrophosphate in treated cells as evidence of pathway inhibition

  • Specificity profiling:

    • Test active compounds against related enzymes in the bacterial cell wall synthesis pathway (e.g., undecaprenyl diphosphate synthase )

    • Evaluate effects on mammalian phosphatases to establish selectivity

For compounds showing promising inhibitory activity, synergy testing with established antibiotics can be performed using checkerboard assays to calculate fractional inhibitory concentration indices (FICI) as demonstrated with other bacterial cell wall synthesis inhibitors . Compounds that show synergy with antibiotics targeting cell wall biosynthesis (FICI ~0.35) but indifferent effects with non-cell wall inhibitors (FICI ~1.45) would be particularly interesting candidates .

What are the most effective methods for studying the role of uppP in B. animalis subsp. lactis cell wall biosynthesis and probiotic functionality?

To comprehensively investigate uppP's role in B. animalis subsp. lactis cell wall biosynthesis and probiotic functionality, researchers should employ multiple complementary approaches:

  • Genetic manipulation strategies:

    • Conditional expression systems: Since uppP is likely essential, develop inducible promoter systems (tetracycline-responsive or riboswitch-based) to control uppP expression levels in B. animalis subsp. lactis.

    • CRISPR interference (CRISPRi): Use catalytically dead Cas9 (dCas9) with uppP-targeting guide RNAs to achieve titratable gene repression without complete deletion.

    • Complementation studies: Express heterologous uppP variants in strains with downregulated native uppP to identify functional conservation and essential domains.

  • Phenotypic characterization of modified strains:

    • Growth analysis: Monitor growth curves under various conditions using optimized media like those developed for B. lactis HN019 (medium 4 with glucose) .

    • Cell morphology assessment: Use phase-contrast and electron microscopy to examine changes in cell shape, size, and division patterns following uppP modulation.

    • Cell wall composition analysis: Quantify peptidoglycan crosslinking, thickness, and chemical composition using techniques like HPLC analysis of muropeptides.

    • Antibiotic susceptibility profiling: Test sensitivity to cell wall-targeting antibiotics like bacitracin, which is known to interact with the uppP pathway .

  • Biochemical pathway analysis:

    • Metabolite profiling: Use LC-MS to quantify undecaprenyl phosphate, undecaprenyl pyrophosphate, and downstream intermediates in cell wall biosynthesis.

    • Pulse-chase experiments: Track the flow of radiolabeled precursors through the peptidoglycan synthesis pathway to identify bottlenecks caused by uppP modulation.

    • In vitro reconstitution: Combine purified uppP with other enzymes in the pathway to study their coordinated function in membranes or artificial liposomes.

  • Probiotic functionality assessment:

    • Adhesion assays: Quantify attachment to intestinal epithelial cell models (e.g., Caco-2 cells) after uppP modulation to assess impact on adherence properties .

    • Acid and bile tolerance: Test survival under simulated gastrointestinal conditions to determine if altered cell wall properties affect probiotic resilience.

    • Immune modulation: Measure cytokine production in intestinal epithelial and immune cell co-culture systems, particularly after LPS challenge as demonstrated with B. lactis HN019 .

    • Exopolysaccharide (EPS) production: Quantify and characterize EPS produced by strains with modified uppP expression, as EPS contributes to probiotic benefits .

  • Interaction with host systems:

    • Barrier function assessment: Measure transepithelial electrical resistance (TEER) and tight junction protein expression in epithelial models exposed to B. lactis with altered uppP levels .

    • Competitive exclusion: Test ability to prevent adhesion of pathogenic bacteria to intestinal cell models.

    • In vivo colonization: Use animal models to assess gut colonization efficiency and persistence of strains with modified uppP expression.

These multilayered approaches will provide a comprehensive understanding of how uppP contributes not only to basic cell wall biosynthesis but also to the specific probiotic properties that make B. animalis subsp. lactis valuable in research and potential applications.

What are the challenges in correlating in vitro uppP enzymatic activity with in vivo bacterial growth and cell wall integrity?

Correlating in vitro uppP enzymatic activity with in vivo bacterial growth and cell wall integrity presents several significant challenges that researchers must address:

  • Membrane environment discrepancies:

    • In vitro assays typically use detergent-solubilized enzyme or simplified membrane mimetics that inadequately reproduce the complex native membrane environment.

    • The composition of bacterial membranes (phospholipids, membrane proteins, lipid microdomains) significantly affects uppP positioning and activity but is difficult to replicate in vitro .

    • Solution: Develop more sophisticated membrane models incorporating native lipid compositions and implement advanced techniques like native nanodiscs or bacterial spheroplasts for enzyme assays.

  • Regulation and interaction networks:

    • uppP likely functions within a coordinated network of cell wall biosynthesis enzymes that may physically or functionally interact, creating emergent properties not observed with the isolated enzyme.

    • Potential post-translational modifications or allosteric regulation mechanisms are lost in purified systems.

    • Solution: Implement proximity labeling techniques (BioID, APEX) to identify interaction partners and regulatory factors; develop co-expression systems for analyzing enzyme complexes.

  • Substrate availability and competition:

    • In vivo, uppP must compete with other enzymes for the undecaprenyl pyrophosphate substrate, and its activity is influenced by the dynamic balance of lipid carrier recycling.

    • Artificial substrates used in vitro (like farnesyl pyrophosphate) may not perfectly mimic the natural substrate .

    • Solution: Develop methods to quantify the undecaprenyl phosphate/pyrophosphate pool sizes and turnover rates in living cells; use native or close synthetic analogs of the natural substrate in assays.

  • Growth conditions and stress responses:

    • Laboratory growth conditions differ substantially from natural environments, potentially altering cell wall biosynthesis demands.

    • Stressors like acids, antibiotics, or nutrient limitation may change the relationship between uppP activity and growth.

    • Solution: Conduct correlations across multiple growth conditions, including those that challenge cell wall integrity (e.g., varying carbon sources as tested with B. lactis HN019) ; measure lactic acid production and its impact on growth .

  • Temporal dynamics:

    • In vitro assays provide snapshots of activity, while in vivo growth represents the integration of enzymatic activity over time with feedback regulation.

    • Cell cycle-dependent variations in cell wall synthesis requirements are missed in biochemical assays.

    • Solution: Develop time-resolved assays and correlate with synchronized cultures; implement microfluidics approaches for single-cell analysis of growth and division.

  • Compensatory mechanisms:

    • Bacteria may compensate for reduced uppP activity through upregulation of alternative pathways or enzymes.

    • The threshold of uppP activity necessary for normal growth may be substantially lower than wild-type levels.

    • Solution: Use graded expression systems to titrate uppP levels; combine with transcriptomic and proteomic analyses to identify compensatory responses.

To address these challenges, researchers should implement integrated approaches that:

  • Combine enzymatic measurements with quantitative growth parameters and cell wall structural analyses

  • Utilize genetics (mutant libraries, CRISPRi) to establish causality

  • Incorporate systems biology approaches to model the relationship between enzymatic activity and physiological outcomes

  • Develop techniques to measure enzyme activity in situ within living cells

These strategies will help establish more meaningful correlations between biochemical measurements and biological significance in the complex context of bacterial physiology.

How can researchers leverage computational approaches to predict uppP inhibitor binding sites and design novel antimicrobial compounds?

Researchers can employ a multi-layered computational strategy to predict uppP inhibitor binding sites and design novel antimicrobials:

  • Structural modeling and active site identification:

    • Homology modeling: Generate B. animalis subsp. lactis uppP structural models based on related bacterial uppP structures, utilizing the Rosetta Fragment Libraries approach and Monte Carlo simulation as demonstrated for E. coli UppP .

    • Active site prediction: Identify the catalytic pocket containing the conserved (E/Q)XXXE and PGXSRSXXT motifs and histidine residue, ensuring key catalytic residues (like those corresponding to Glu-21, His-30, and Arg-174 in E. coli) are positioned within approximately 10 Å of each other .

    • Molecular dynamics simulations: Refine models through extended simulations in explicit membrane environments to capture conformational dynamics relevant to inhibitor binding.

  • Binding site characterization:

    • Pocket analysis: Use computational tools (LIGSITE, DoGSiteScorer) to identify and characterize druggable pockets beyond the catalytic site.

    • Fragment mapping: Employ computational solvent mapping to identify binding hot spots and preferred interaction types within the pockets.

    • Electrostatic analysis: Generate electrostatic potential maps to identify charge distributions that can guide inhibitor design.

  • Structure-based virtual screening:

    • Pharmacophore modeling: Develop pharmacophore models based on known inhibitors like bacitracin (IC₅₀ = 32 μM for E. coli UPPP) and benzoic acid derivatives .

    • Docking campaigns: Screen compound libraries against the uppP model using molecular docking, incorporating membrane constraints and explicit consideration of the lipid bilayer interface.

    • Consensus scoring: Apply multiple scoring functions to prioritize compounds, focusing on those that interact with catalytically important residues.

  • Ligand-based design approaches:

    • QSAR modeling: Develop quantitative structure-activity relationships using known inhibitors like the benzoic acid derivatives, focusing on the correlation between bacterial growth inhibition and enzyme inhibition .

    • Scaffold hopping: Design novel chemical scaffolds that maintain key interaction features while improving properties like membrane permeability.

    • Bioisostere replacement: Systematically modify known inhibitors by replacing functional groups with bioisosteres to optimize activity.

  • Advanced simulation techniques:

    • Free energy calculations: Employ methods like MM-PBSA, FEP, or thermodynamic integration to predict binding affinities of designed compounds.

    • Metadynamics: Explore conformational space and identify cryptic binding sites that may not be evident in static structures.

    • Coarse-grained simulations: Model interactions with the membrane environment over longer timescales to predict membrane partitioning and access to the binding site.

  • Machine learning integration:

    • Deep learning models: Train neural networks on existing inhibitor data to predict activity of novel compounds.

    • Generative models: Utilize generative adversarial networks (GANs) or variational autoencoders (VAEs) to design new chemical entities with predicted activity against uppP.

    • Active learning: Implement iterative design-test-refine cycles that incorporate experimental feedback to improve predictive models.

  • Multi-target design considerations:

    • Dual inhibitor design: Create compounds targeting both uppP and related enzymes like undecaprenyl diphosphate synthase (UPPS) to increase efficacy and reduce resistance development .

    • Synergy prediction: Predict compounds likely to show synergistic effects with existing antibiotics targeting cell wall biosynthesis, as observed with benzoic acid inhibitors (FICI ~0.35) .

This comprehensive computational approach should be validated through experimental testing, with promising candidates synthesized and evaluated using the enzymatic and cell-based assays described in previous FAQs.

What experimental approaches can resolve contradictions in data between uppP activity measurements and bacterial phenotypes?

Resolving contradictions between uppP activity measurements and bacterial phenotypes requires sophisticated experimental approaches that bridge in vitro biochemistry with in vivo biology:

  • Comprehensive phenotypic characterization:

    • Growth parameter dissection: Rather than relying on single metrics like final OD or CFU counts, analyze multiple growth parameters including lag phase duration, exponential growth rate, and stationary phase behavior across different media compositions, as demonstrated with B. lactis HN019 on various carbon sources .

    • Morphological analysis: Implement advanced microscopy techniques (super-resolution, electron microscopy) to detect subtle changes in cell wall ultrastructure, cell shape, and division patterns that may not be reflected in growth curves.

    • Viability versus culturability: Use live/dead staining and single-cell techniques to distinguish between metabolically active cells and those capable of forming colonies, revealing potential viable but non-culturable states resulting from cell wall stress.

  • In situ enzyme activity measurement:

    • Activity-based protein profiling: Develop chemical probes that covalently label active uppP in living cells, allowing quantification of functionally active enzyme rather than just protein levels.

    • FRET-based biosensors: Engineer sensors that detect undecaprenyl phosphate/pyrophosphate ratios in living cells to monitor uppP activity in real-time.

    • Metabolic flux analysis: Implement stable isotope labeling to track the flow of precursors through the cell wall synthesis pathway, identifying potential metabolic bottlenecks or compensatory fluxes.

  • Genetic complementation and suppressor analysis:

    • Point mutant complementation: Generate a library of uppP variants with targeted mutations in catalytic residues and assess their ability to complement growth defects, correlating specific catalytic properties with phenotypic outcomes.

    • Suppressor mutation screening: Identify second-site mutations that restore growth in strains with defective uppP, revealing genetic interactions and compensatory pathways.

    • Heterologous expression: Test whether uppP enzymes from other species with known biochemical properties can restore growth phenotypes, establishing minimum activity thresholds required for viability.

  • Integrated multi-omics approaches:

    • Transcriptomics: Profile gene expression changes in response to uppP modulation to identify compensatory mechanisms and stress responses that may explain phenotypic discrepancies.

    • Proteomics: Quantify changes in protein levels, particularly for other cell wall biosynthesis enzymes, to detect post-transcriptional compensatory responses.

    • Peptidoglycan analysis: Implement detailed muropeptide profiling using mass spectrometry to detect subtle changes in cell wall composition that may compensate for altered uppP activity.

    • Lipidomics: Analyze changes in membrane lipid composition that might affect uppP function in vivo or compensate for reduced activity.

  • Controlled expression systems:

    • Titratable promoters: Develop expression systems that allow precise control of uppP levels, creating a dose-response relationship between enzyme expression and phenotype.

    • Time-resolved analysis: Implement rapid induction or repression systems to study the temporal relationship between changes in uppP activity and phenotypic manifestations.

    • Single-cell analysis: Use microfluidics and time-lapse microscopy to correlate uppP expression (using fluorescent reporters) with growth and division at the single-cell level, revealing population heterogeneity that may mask correlations in bulk measurements.

  • Environmental and stress response integration:

    • Condition matrix experiments: Test uppP activity-phenotype correlations across matrices of environmental conditions (pH, osmolarity, temperature) to identify context-dependent relationships.

    • Cell wall stress stimulons: Analyze activation of cell wall stress responses in relation to uppP activity to determine whether compensatory mechanisms are activated.

    • Antibiotic sensitivity profiling: Create detailed profiles of sensitivity to multiple classes of cell wall-targeting antibiotics at sub-MIC concentrations to detect subtle changes in cell wall integrity.

By integrating these approaches, researchers can develop a more nuanced understanding of the relationship between biochemical activity and physiological outcomes, resolving apparent contradictions and establishing mechanistic links between uppP function and bacterial phenotypes.

How can researchers utilize interspecies comparative analysis to understand evolutionary adaptations in uppP functionality?

Utilizing interspecies comparative analysis to understand evolutionary adaptations in uppP functionality requires a multifaceted approach that integrates genomics, biochemistry, and structural biology:

  • Comprehensive phylogenetic analysis:

    • Sequence collection and alignment: Gather uppP sequences from diverse bacterial phyla, with particular focus on probiotic species related to B. animalis subsp. lactis and other bifidobacteria.

    • Phylogenetic tree construction: Generate phylogenetic trees using maximum likelihood or Bayesian methods to visualize evolutionary relationships.

    • Selection pressure analysis: Calculate Ka/Ks ratios to identify residues under positive, negative, or neutral selection, revealing functional constraints and adaptive evolution.

    • Ancestral sequence reconstruction: Infer ancestral uppP sequences at key evolutionary nodes to understand the trajectory of functional changes.

  • Structure-guided sequence comparison:

    • Conservation mapping: Map sequence conservation onto structural models to identify consistently preserved regions versus variable regions.

    • Coevolution analysis: Implement statistical coupling analysis or mutual information approaches to detect co-evolving residue networks that may reveal functional constraints not apparent from conservation alone.

    • Catalytic site comparison: Compare the geometry and composition of the active site containing the (E/Q)XXXE and PGXSRSXXT motifs across species, focusing on variations that might alter substrate specificity or catalytic efficiency .

    • Membrane interaction analysis: Examine differences in predicted transmembrane domains and membrane-interacting regions that may reflect adaptation to different cell envelope architectures.

  • Experimental validation through heterologous expression:

    • Cross-species complementation: Express uppP from diverse bacterial species in a model organism with controllable native uppP expression to assess functional conservation and adaptation.

    • Chimeric enzyme construction: Generate chimeric uppP enzymes by swapping domains between species to identify regions responsible for specific functional properties.

    • Site-directed mutagenesis validation: Convert residues in one species' uppP to the corresponding residues in another species to test their contribution to observed functional differences.

  • Comparative biochemical characterization:

    • Substrate specificity profiling: Test activity of uppP enzymes from different species against varying chain length prenyl pyrophosphates to detect adaptations in substrate preference.

    • Kinetic parameter determination: Compare Km, kcat, and catalytic efficiency (kcat/Km) values across species to identify variations in catalytic properties.

    • pH and temperature optima: Establish activity profiles across pH and temperature ranges to detect adaptations to different environmental niches.

    • Inhibitor sensitivity comparison: Test sensitivity to inhibitors like bacitracin across species to identify variations in binding site architecture .

  • Ecological and genomic context integration:

    • Genome neighborhood analysis: Compare the genomic context of uppP across species to identify co-evolved gene clusters related to cell wall biosynthesis.

    • Habitat correlation: Correlate functional adaptations with bacterial habitat (gut-associated, soil, extreme environments) to identify environment-specific adaptations.

    • Cell wall architecture comparison: Integrate knowledge about species-specific peptidoglycan structures and cell envelope composition to understand how uppP has adapted to support different cell wall types.

    • Growth condition adaptations: Compare growth patterns across species in response to varying carbon sources, similar to the studies performed with B. lactis HN019 , to identify metabolic adaptations that may influence cell wall biosynthesis requirements.

  • Probiotic-specific functional analysis:

    • Gut environment adaptation: Compare uppP from probiotic bifidobacteria with non-probiotic species to identify adaptations specific to the gut environment.

    • Host-interaction factors: Correlate uppP variations with differences in adhesion properties, exopolysaccharide production, and immunomodulatory effects observed among probiotic strains .

    • Stress resistance correlation: Analyze relationships between uppP variations and resistance to bile salts, acid stress, and antimicrobial peptides encountered in the gut.

What are the most critical methodological considerations for ensuring reproducibility in recombinant uppP expression and activity assays?

Ensuring reproducibility in recombinant uppP expression and activity assays requires meticulous attention to numerous methodological details:

  • Expression system standardization:

    • Vector design documentation: Maintain detailed records of construct design including promoter choice, affinity tags, linker sequences, and codon optimization strategies.

    • Expression strain consistency: Use the same bacterial strain batch for all expressions; document strain genotype and storage conditions.

    • Growth media preparation: Implement standardized protocols for media preparation with defined components rather than complex media when possible; for B. animalis studies, use defined media like medium 4 with glucose as characterized for B. lactis HN019 .

    • Induction parameters: Precisely control induction timing, inducer concentration, temperature shift protocols, and harvest points based on growth curves rather than arbitrary time points.

  • Membrane protein purification controls:

    • Detergent quality assurance: Use freshly prepared detergent solutions or validate detergent quality before use; implement consistent detergent:protein ratios throughout purification.

    • Buffer composition consistency: Prepare buffers with analytical grade reagents and verify pH at the temperature of use; include precise concentrations of stabilizing additives like glycerol and divalent cations.

    • Temperature management: Maintain consistent temperature throughout membrane isolation and protein purification steps, typically 4°C to prevent protein degradation.

    • Protein quantification methods: Apply multiple protein quantification methods (Bradford, BCA, absorbance at 280 nm with calculated extinction coefficient) to ensure consistent protein concentration determination.

  • Activity assay standardization:

    • Substrate preparation and storage: Document substrate synthesis or commercial source; establish standardized storage conditions and validate substrate integrity before assays.

    • Reaction vessel considerations: Use consistent reaction vessel materials (glass vs. plastic) and surface-to-volume ratios as these can affect membrane protein behavior.

    • Temperature control precision: Utilize calibrated heat blocks or water baths with temperature monitoring throughout incubation periods.

    • Reaction quenching timing: Implement precise and consistent methods for stopping reactions, particularly important for Malachite Green phosphate detection assays .

  • Data collection and analysis protocols:

    • Instrument calibration: Regularly calibrate spectrophotometers, fluorimeters, and other analytical instruments; include calibration standards in each experiment.

    • Technical replication: Perform at least triplicate measurements for each condition; report individual measurements rather than only averages.

    • Data fitting methods: Document software packages, algorithms, and constraints used for kinetic parameter determination; share raw data and analysis scripts.

    • Statistical approach: Apply appropriate statistical tests with reported sample sizes, variance measures, and significance thresholds.

  • Quality control checkpoints:

    • Protein purity assessment: Implement consistent SDS-PAGE and/or size exclusion chromatography protocols to verify protein homogeneity across preparations.

    • Functional benchmarking: Include a standard uppP preparation or control enzyme in each assay batch to normalize for day-to-day variations.

    • Enzyme stability monitoring: Develop and apply thermal shift assays or activity decay measurements to ensure comparable protein stability across preparations.

    • Mass spectrometry validation: Periodically confirm protein identity and integrity through mass spectrometry to detect potential proteolysis or modifications.

  • Documentation and reporting practices:

    • Method detail inclusion: Provide comprehensive methods sections including seemingly minor details like centrifuge models, tube types, and mixing methods.

    • Batch tracking: Maintain records connecting specific protein preparations with experimental results to identify batch-dependent variations.

    • Reagent sourcing: Document manufacturer information, catalog numbers, and lot numbers for critical reagents.

    • Failure reporting: Report failed experiments and troubleshooting steps to identify sensitive parameters affecting reproducibility.

  • Specialized considerations for uppP:

    • Phosphate contamination control: Implement rigorous phosphate-free conditions for Malachite Green assays, including glassware washing protocols and reagent purity verification .

    • Detergent interference testing: Validate that detergents used for uppP solubilization do not interfere with activity assay detection methods.

    • Lipid addition protocols: If supplementing with additional lipids, standardize lipid preparation methods, vesicle formation, and incorporation procedures.

By systematically controlling these variables and documenting methodologies in detail, researchers can significantly improve reproducibility in uppP studies across different laboratories and experimental batches.

How can researchers accurately quantify undecaprenyl phosphate levels in bacterial cultures to correlate with uppP activity?

Accurately quantifying undecaprenyl phosphate (UP) levels in bacterial cultures to correlate with uppP activity presents significant technical challenges due to the compound's membrane localization and relatively low abundance. Researchers can employ these specialized approaches:

  • Extraction and sample preparation protocols:

    • Optimized extraction methods: Implement two-phase extraction using acidified organic solvents (chloroform/methanol/HCl) specifically optimized for phospholipids. Critical parameters include:

      • Rapid sample processing to prevent enzymatic degradation

      • Precise pH control during extraction (typically pH 2-3)

      • Addition of antioxidants to prevent oxidation of polyisoprene chains

      • Internal standards addition (e.g., synthetic UP analogs with different chain lengths)

    • Sample concentration: Employ solid-phase extraction (SPE) with silica or C18 cartridges to concentrate UP from large culture volumes, allowing detection of low-abundance species.

    • Derivatization strategies: For improved detection sensitivity, develop chemical derivatization approaches targeting the phosphate group (e.g., fluorescent phosphate-binding reagents).

  • Analytical detection methods:

    • LC-MS/MS analysis: Develop liquid chromatography coupled with tandem mass spectrometry methods using:

      • Reverse-phase HPLC with C8 or C18 columns and gradient elution

      • Electrospray ionization in negative mode to detect the phosphate group

      • Multiple reaction monitoring (MRM) to track specific fragment ions characteristic of UP

      • High-resolution MS to distinguish UP from isobaric lipid species

    • Thin-layer chromatography (TLC): Implement specialized TLC systems with phosphate-specific detection:

      • Molybdenum blue staining for phospholipid detection

      • Radioactive labeling with ³²P-phosphate

      • Specific UP standards for Rf value comparison

    • NMR-based approaches: For detailed structural confirmation, utilize ³¹P NMR to specifically detect and quantify phosphate-containing lipids.

  • Metabolic labeling strategies:

    • Radioisotope incorporation: Culture bacteria with ³²P-phosphate or ³H-isoprene precursors to specifically label the UP pool, enabling sensitive detection through scintillation counting after chromatographic separation.

    • Stable isotope labeling: Incorporate ¹³C-labeled precursors followed by MS detection to distinguish newly synthesized UP from existing pools, providing information on synthesis rates.

    • Azide-alkyne click chemistry: Develop metabolic incorporation of azide-modified prenyl precursors followed by click chemistry for fluorescent tagging and detection.

  • UP pool dynamics assessment:

    • Pulse-chase experiments: Implement pulse-chase protocols with labeled precursors to determine UP turnover rates and distinguish between effects on synthesis versus degradation.

    • Time-course sampling: Develop rapid sampling techniques combined with immediate extraction to capture temporal dynamics of UP levels following uppP inhibition or genetic manipulation.

    • Cellular fractionation: Compare UP levels in different membrane fractions to assess potential spatial heterogeneity in its distribution and processing.

  • Correlation with uppP activity:

    • Parallel enzyme assays: Simultaneously measure uppP activity in membrane fractions or with purified enzyme while quantifying UP levels in cultures.

    • Genetic titration: Create strains with controllable uppP expression levels to establish a dose-response relationship between enzyme levels and UP accumulation.

    • Inhibitor studies: Treat cultures with specific uppP inhibitors at varying concentrations to correlate inhibition potency with UP/UPP ratios.

    • Mathematical modeling: Develop kinetic models incorporating enzyme activity measurements, substrate availability, and product formation rates to predict and interpret UP level changes.

  • Controls and validation:

    • Method validation parameters: Establish limits of detection, quantification ranges, precision, and accuracy specifically for UP in bacterial extracts.

    • Recovery determination: Use spiked samples with synthetic UP standards to determine extraction efficiency and matrix effects.

    • Comparison with precursor/product ratios: Simultaneously measure undecaprenyl pyrophosphate (UPP) levels to calculate UPP/UP ratios as a direct indicator of uppP activity.

By implementing these specialized approaches and rigorously validating the methodology, researchers can establish reliable correlations between uppP enzymatic activity and its impact on cellular UP levels, providing critical insights into the enzyme's physiological role and the effects of potential inhibitors.

What specialized techniques are required for studying the interaction of uppP with other enzymes in the bacterial cell wall synthesis pathway?

Studying interactions between uppP and other enzymes in the bacterial cell wall synthesis pathway requires specialized techniques that can capture transient, membrane-associated protein complexes:

  • Membrane protein-protein interaction detection methods:

    • In vivo crosslinking: Implement chemical crosslinking with membrane-permeable agents (formaldehyde, DSP, or photo-activatable crosslinkers) followed by immunoprecipitation or pull-down assays to capture native complexes.

    • Split reporter systems: Adapt protein-fragment complementation assays (split-GFP, split-luciferase) for membrane proteins by optimizing the position of reporter fragments relative to transmembrane domains.

    • FRET/BRET approaches: Develop Förster resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) pairs by fusing fluorescent proteins or luciferase/fluorophore combinations to uppP and potential interaction partners, with careful consideration of membrane topology.

    • Proximity labeling: Implement BioID (biotin ligase) or APEX2 (ascorbate peroxidase) fusion proteins to identify proximal proteins in living cells through biotinylation of nearby proteins followed by streptavidin pull-down and mass spectrometry.

  • Reconstituted membrane systems:

    • Co-reconstitution protocols: Develop methods to co-reconstitute purified uppP with other cell wall synthesis enzymes in defined liposome systems with appropriate lipid compositions.

    • GUV-based assays: Create giant unilamellar vesicles (GUVs) containing fluorescently labeled enzymes to visualize potential co-localization and complex formation through confocal microscopy.

    • Supported lipid bilayers: Implement supported bilayer systems with tethered enzymes for surface-sensitive techniques like total internal reflection fluorescence (TIRF) microscopy or surface plasmon resonance (SPR).

    • Nanodisc assembly: Co-reconstitute uppP with potential interaction partners in nanodiscs for structural studies and single-molecule functional assays.

  • Functional coupling assays:

    • Coupled enzyme assays: Develop continuous assays where the product of one enzyme serves as the substrate for the next, allowing detection of functional coupling and substrate channeling between uppP and partner enzymes.

    • Metabolic flux analysis: Implement stable isotope labeling to track the flow of metabolites through sequential steps in the pathway, identifying potential rate-limiting steps and metabolite channeling.

    • Real-time activity monitoring: Create fluorescent or FRET-based sensors that report on the activities of multiple enzymes simultaneously to detect coordinated regulation.

    • Single-molecule analysis: Develop total internal reflection fluorescence (TIRF) microscopy approaches to observe individual enzyme molecules and their interactions in supported membrane systems.

  • Structural approaches for membrane protein complexes:

    • Cryo-electron microscopy: Optimize sample preparation for membrane protein complexes, potentially using nanodiscs or amphipols to maintain native-like environments for high-resolution structural determination.

    • Cross-linking mass spectrometry (XL-MS): Implement specialized crosslinkers followed by mass spectrometry analysis to identify interaction interfaces between uppP and partner proteins.

    • HDX-MS applications: Adapt hydrogen-deuterium exchange mass spectrometry for membrane proteins to identify regions with altered solvent accessibility upon complex formation.

    • Solid-state NMR: Develop magic angle spinning NMR methods for studying labeled proteins in native-like membrane environments to detect structural changes upon complex formation.

  • Genetic and phenotypic correlation techniques:

    • Synthetic genetic arrays: Systematically combine mutations or expression modulations in uppP with those in other cell wall synthesis genes to identify genetic interactions indicating functional relationships.

    • Suppressor screening: Identify second-site mutations that suppress phenotypes caused by uppP mutations to reveal functional connections.

    • Chemical genetic profiling: Test how modulation of uppP activity affects sensitivity to inhibitors targeting other steps in cell wall synthesis.

    • Co-expression analysis: Analyze transcriptomic data across various conditions to identify genes whose expression patterns correlate with uppP, suggesting co-regulation and potential functional relationships.

  • Cell biology approaches:

    • Super-resolution microscopy: Implement techniques like STORM, PALM, or structured illumination microscopy to visualize the nanoscale co-localization of fluorescently tagged uppP with other cell wall synthesis machinery.

    • Single-particle tracking: Develop methods to track the diffusion and clustering behavior of individual enzyme molecules in living bacterial membranes to identify potential interaction sites.

    • Bacterial two-hybrid systems: Adapt bacterial two-hybrid approaches specifically for membrane proteins to screen for potential interaction partners.

    • Fluorescence recovery after photobleaching (FRAP): Measure the diffusion dynamics of fluorescently labeled enzymes to detect changes in mobility that might indicate complex formation.

  • Interactome mapping specific to cell wall synthesis:

    • Targeted proteomics: Develop selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) mass spectrometry methods to quantify specific cell wall synthesis proteins in immunoprecipitated complexes.

    • Complexome profiling: Implement native gel electrophoresis combined with mass spectrometry to identify intact protein complexes involving uppP.

    • Interactome databases integration: Develop computational approaches to integrate experimental interaction data with existing databases and predictions to build comprehensive models of the cell wall synthesis interactome.

By combining multiple complementary approaches from this toolkit, researchers can build a comprehensive understanding of how uppP functions within the broader context of bacterial cell wall synthesis, potentially revealing novel regulatory mechanisms and targets for antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.