Recombinant Bifidobacterium longum Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Biological Context of B. longum

Bifidobacterium longum is a gram-positive, anaerobic bacterium that represents one of the most abundant bacterial species in the infant gut microbiome. Its relative abundance naturally declines with age but remains a significant component of the adult gut microbiota . B. longum exerts numerous beneficial health effects through the production of bioactive substances and surface-associated molecules that interact with the host . The bacterium is an excellent colonizer of the human gut, with some strains persisting for extended periods after a single administration .

Genetic Conservation and Expression

The lgt gene is highly conserved among strains of B. longum subsp. longum and B. longum subsp. infantis, indicating its essential role in bacterial physiology . This conservation suggests evolutionary pressure to maintain lgt functionality across different strains, highlighting its importance in bacterial survival and adaptation.

Biochemical Function

The primary function of lgt is catalyzing the first step in bacterial lipoprotein maturation. This process involves the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of a cysteine residue within a conserved "lipobox" motif found in the signal peptide of bacterial prolipoproteins. This reaction is essential for the proper anchoring of lipoproteins to the bacterial membrane.

Role in Bacterial Physiology

Lipoproteins modified by lgt serve various critical functions in B. longum, including:

  • Nutrient acquisition and transport

  • Cell envelope integrity maintenance

  • Host-microbe interactions

  • Stress responses

  • Adherence to intestinal surfaces

These functions contribute to the remarkable ability of B. longum to colonize and persist in the human gut, where it can provide health benefits through interactions with the host immune system and other physiological processes .

Expression Systems

Recombinant B. longum Prolipoprotein diacylglyceryl transferase is typically produced using bacterial expression systems, with Escherichia coli being the most common host organism. The recombinant protein is often expressed with affinity tags, such as histidine (His) tags, to facilitate purification . The expression construct typically includes the full-length sequence of the lgt gene from B. longum, optimized for expression in the host system.

Purification Methods

The purification of recombinant lgt protein generally follows standard protocols for membrane proteins, including:

  1. Cell lysis under conditions that preserve protein structure

  2. Membrane solubilization using appropriate detergents

  3. Affinity chromatography using the attached His-tag

  4. Additional purification steps such as ion exchange or size exclusion chromatography

  5. Quality assessment by SDS-PAGE and other analytical methods

Protein Properties

The recombinant B. longum lgt protein exhibits specific biochemical and biophysical properties that influence its handling and applications. Table 1 summarizes these key properties based on available data from similar recombinant proteins.

Table 1: Properties of Recombinant B. longum Prolipoprotein diacylglyceryl transferase

PropertyCharacteristic
Molecular WeightApproximately 30-35 kDa (including His-tag)
Isoelectric PointTypically in the range of 5.5-6.5
SolubilityRequires detergents for solubilization
StorageStable as lyophilized powder; recommended storage at -20°C/-80°C
ReconstitutionOptimal in Tris/PBS-based buffer with 6% Trehalose, pH 8.0
StabilityMultiple freeze-thaw cycles not recommended

Development of Novel Antimicrobials

Since lgt is essential for bacterial viability and has no homolog in mammalian cells, it represents a potential target for the development of novel antimicrobials. Recombinant lgt protein can be used in high-throughput screening assays to identify compounds that selectively inhibit its activity, potentially leading to new therapeutic approaches for managing pathogenic bacteria.

Biotechnological Applications

The enzyme's ability to modify specific protein sequences with lipid moieties has potential applications in biotechnology, including:

  • Development of novel protein delivery systems

  • Creation of improved vaccine adjuvants

  • Engineering of membrane-associated proteins with enhanced stability

Sequence Homology

Comparison of B. longum lgt with homologous proteins from other bacterial species reveals both conserved and variable regions. Table 2 presents a comparison of B. longum lgt with lgt proteins from other significant bacterial species.

Table 2: Comparison of lgt Proteins Across Bacterial Species

SpeciesSequence Identity with B. longum lgtKey Differences
Prochlorococcus marinus27-28%Different membrane-anchoring regions
Other Bifidobacterial species70-90% (estimated)Minor variations in transmembrane domains
E. coli30-35% (estimated)Differences in substrate specificity
Gram-positive pathogens25-40% (estimated)Variations in catalytic efficiency

Functional Conservation

Despite sequence variations, the catalytic mechanism of lgt appears to be highly conserved across bacterial species. This functional conservation underscores the enzyme's fundamental importance in bacterial physiology while specific variations may reflect adaptations to different membrane compositions and ecological niches.

Recent Advances

Recent research has expanded our understanding of the role of bacterial lipoproteins in host-microbe interactions. Studies of B. longum have revealed that surface-associated molecules, including lipoproteins, contribute to its beneficial effects on human health . These insights highlight the potential significance of lgt in mediating B. longum's probiotic properties.

Ongoing Research Challenges

Several aspects of B. longum lgt remain to be fully elucidated, including:

  • Detailed three-dimensional structure

  • Precise substrate specificity

  • Regulation of expression under different environmental conditions

  • Role in mediating specific host-microbe interactions

Future Applications

The continued study of recombinant B. longum lgt may lead to several promising applications:

  1. Development of targeted probiotics with enhanced colonization capabilities

  2. Creation of novel delivery systems for therapeutic proteins

  3. Engineering of bacterial strains with improved stability and functionality

  4. Design of selective antimicrobials targeting pathogenic bacteria while sparing beneficial species

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
lgt; BL0754; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Bifidobacterium longum (strain NCC 2705)
Target Names
lgt
Target Protein Sequence
MNLAYIPSPTFSKFEIGPFTIHMYAICILIGICVAVWILATRWKRYGGTFDQILDTTLVT VPCALVGARLYHCITTPADYFPPTGNLVNILKVWEGGMAIFGGISVGTLVAFLWCRHKHY PFAIFADAIAPALPVAQAIGRLGNWFNQELYGWPTTLPWGLKLNDADAIGKSEICYSGAQ CPDYRTTLFHPTFLYEMIWNLIGAALIIYLGHKLADRLKAGQQFAMYLMWYGLGRTWIEN VRINYSTVILGLRTNVWTAIIVFVLGCILFVVLYQYGPDPKAQARGLAAVTADELERQSI EEEQLRQKKQTNRTK
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: blo:BL0754

STRING: 206672.BL0754

Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) in Bifidobacterium longum?

Prolipoprotein diacylglyceryl transferase (lgt) is an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification process of bacterial lipoproteins. This enzyme transfers a diacylglyceryl group from phosphatidylglycerol to a cysteine residue in the lipobox of prolipoproteins, forming a thioether linkage. In Bifidobacterium longum, this modification is crucial for proper anchoring of lipoproteins to the bacterial membrane . Crystal structures of related lgt enzymes (such as from E. coli) reveal the presence of two binding sites and specific residues essential for catalytic function .

What is the evolutionary significance of lgt in bacterial systems?

Lgt is widely conserved across bacterial species, indicating its fundamental role in bacterial physiology. Deletion of the lgt gene is lethal to most Gram-negative bacteria, highlighting its essential nature . In Bifidobacterium species, including B. longum, lgt plays a vital role in surface protein modification, influencing bacterial interactions with host cells and other microorganisms. Comparative genomic analyses suggest that while the core catalytic mechanism is conserved, subtle variations exist in substrate specificity and regulatory mechanisms across bacterial phyla.

How does Bifidobacterium longum lgt differ from lgt in other bacterial species?

While the primary function of lgt is conserved across bacterial species, B. longum lgt has specific adaptations reflecting its probiotic nature and gut environment adaptation. The primary structure contains conserved catalytic residues (analogous to Arg143 and Arg239 in E. coli lgt) essential for diacylglyceryl transfer . B. longum lgt is optimized to function in the slightly acidic environment of the gut, where this probiotic bacterium colonizes. Sequence analysis suggests potential differences in substrate specificity compared to pathogenic bacterial lgt enzymes, which could be relevant for selective targeting in antimicrobial development.

What expression systems are most effective for recombinant B. longum lgt production?

The optimal expression system for recombinant B. longum lgt must address the challenges inherent to membrane protein production. E. coli-based systems utilizing vectors with tightly regulated promoters (T7, araBAD) have proven effective for controlled expression. The addition of a fusion tag (His6, MBP, or SUMO) facilitates purification and can enhance solubility. Expression temperatures below 30°C and induction with reduced inducer concentrations often yield higher amounts of properly folded protein. Alternative expression hosts such as Lactococcus lactis or cell-free systems may be considered for difficult-to-express constructs.

What are the critical parameters for successful purification of active recombinant B. longum lgt?

Successful purification of active B. longum lgt requires careful consideration of multiple parameters:

  • Membrane solubilization: Detergent selection is critical, with mild detergents like DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) often preserving activity better than harsh ionic detergents.

  • Buffer composition: Phosphate or HEPES buffers (pH 7.0-7.5) with physiological salt concentrations (150-300 mM NaCl) generally maintain stability.

  • Purification strategy: A two-step approach combining affinity chromatography (typically IMAC for His-tagged constructs) followed by size exclusion chromatography yields the highest purity.

  • Stability enhancers: Addition of glycerol (10-20%), reducing agents, and sometimes specific phospholipids can enhance stability during purification.

  • Temperature control: Maintaining samples at 4°C throughout purification reduces degradation.

Incorporating activity assays at key purification steps ensures that the final product retains enzymatic function.

What analytical methods are appropriate for assessing purity and activity of recombinant B. longum lgt?

Multiple complementary analytical methods should be employed:

MethodApplicationKey Parameters
SDS-PAGEPurity assessmentUse of specialized membrane protein visualization techniques (silver staining)
Western BlottingIdentity confirmationAntibodies against the target or affinity tag
Size Exclusion ChromatographyHomogeneity analysisDetergent selection affects elution profile
Mass SpectrometryMolecular weight confirmationSpecial considerations for membrane proteins
Circular DichroismSecondary structure assessmentDetergent background must be subtracted
Enzymatic AssayActivity confirmationRadiolabeled or fluorescently labeled substrates

For enzymatic activity, the gold standard involves incubating the purified enzyme with a synthetic prolipoprotein substrate and phosphatidylglycerol, followed by detection of the lipidated product using mass spectrometry or gel-shift assays.

What strategies overcome the challenges of membrane protein crystallization for B. longum lgt structural studies?

Membrane protein crystallization presents unique challenges that require specialized approaches:

  • Construct optimization: Creating truncated versions or chimeric constructs with crystallization-promoting fusion partners (T4 lysozyme, BRIL) can enhance crystallization propensity.

  • Detergent screening: Systematic screening of detergents and detergent-lipid mixtures is critical, with shorter-chain detergents sometimes facilitating crystal contacts.

  • Lipid cubic phase (LCP) crystallization: This method maintains the membrane protein in a lipidic environment, often yielding better-diffracting crystals than traditional vapor diffusion methods.

  • Antibody fragment co-crystallization: Adding Fab or nanobody fragments increases the hydrophilic surface area available for crystal contacts.

  • Thermostability screening: Selecting the most thermostable constructs through fluorescence-based thermal shift assays enhances crystallization success rates.

Successful crystallization of E. coli lgt at 1.9 Å resolution was achieved using these principles, providing a template for B. longum lgt structural studies .

How can cryo-electron microscopy be applied to study B. longum lgt structure and dynamics?

Cryo-electron microscopy (cryo-EM) offers several advantages for B. longum lgt structural studies:

  • Sample preparation: Reconstitution into nanodiscs or amphipols provides a more native-like environment than detergent micelles.

  • Size considerations: While lgt (~30 kDa) is below the traditional size limit for cryo-EM, recent advances in detector technology and processing algorithms have lowered this threshold.

  • Conformational heterogeneity: Cryo-EM can capture multiple conformational states in a single dataset, revealing dynamics important for the catalytic cycle.

  • Substrate complexes: The technique allows visualization of lgt in complex with its lipid and protein substrates under near-native conditions.

  • Integration with other methods: Molecular dynamics simulations based on cryo-EM structures can provide insights into substrate recognition and catalytic mechanism.

What computational approaches complement experimental structural studies of B. longum lgt?

Computational methods significantly enhance structural understanding of B. longum lgt:

  • Homology modeling: Using the E. coli lgt crystal structure (1.9 Å resolution) as a template provides a reasonable starting model for B. longum lgt .

  • Molecular dynamics simulations: These reveal dynamic properties, including conformational changes during catalysis and interactions with the lipid bilayer.

  • Quantum mechanics/molecular mechanics (QM/MM) calculations: These provide detailed insights into the catalytic mechanism at the atomic level.

  • Ligand docking: Virtual screening of substrate analogs or potential inhibitors predicts binding modes and interaction energies.

  • Coevolutionary analysis: Methods like direct coupling analysis (DCA) identify residue pairs that have coevolved, providing constraints for structural modeling.

  • Integrative modeling: Combining low-resolution experimental data with computational methods yields more accurate structural models than either approach alone.

What is the proposed catalytic mechanism of B. longum lgt?

Based on structural and biochemical studies of bacterial lgt enzymes, the catalytic mechanism for B. longum lgt likely proceeds as follows:

  • Binding of phosphatidylglycerol substrate in a specific pocket within the transmembrane region.

  • Recognition and binding of the prolipoprotein substrate, positioning the target cysteine residue in proximity to the phosphatidylglycerol.

  • Nucleophilic attack by the cysteine thiol group on the sn-1 position of phosphatidylglycerol, facilitated by conserved arginine residues (Arg143 and Arg239 in E. coli lgt) that stabilize the transition state .

  • Formation of a thioether linkage and release of glycerol-1-phosphate.

  • Lateral diffusion of the lipidated prolipoprotein out of the enzyme into the membrane.

Critical residues include conserved arginines that interact with the phosphate group of phosphatidylglycerol and potentially act as the catalytic base that activates the cysteine thiol.

How can substrate specificity of B. longum lgt be experimentally determined?

Comprehensive assessment of B. longum lgt substrate specificity requires multi-faceted approaches:

  • Lipid substrate variations: Testing various phospholipids (phosphatidylglycerol, phosphatidylethanolamine, phosphatidylcholine) with different acyl chain lengths and saturations using thin-layer chromatography or mass spectrometry-based assays.

  • Prolipoprotein substrate variations: Employing synthetic peptides with systematic variations in the lipobox sequence ([LVI][ASTVI][GAS][C]) to determine sequence preferences.

  • Kinetic analysis: Determining Km and kcat values for different substrates using radiometric or fluorescence-based assays.

  • Competition assays: Measuring relative preference when multiple substrates are present simultaneously.

  • Structural studies: Co-crystallization or molecular docking with various substrates to identify key interaction residues.

  • Mutagenesis: Creating point mutations in the substrate binding pocket to alter specificity patterns.

The results would be presented as a specificity matrix correlating structural features with kinetic parameters.

What are the key differences in substrate recognition between B. longum lgt and lgt from pathogenic bacteria?

Comparative analysis reveals several potentially exploitable differences:

  • Lipobox recognition: While the canonical lipobox motif ([LVI][ASTVI][GAS][C]) is recognized by all bacterial lgt enzymes, subtle preferences exist for specific residues at each position.

  • Phospholipid preference: E. coli lgt primarily uses phosphatidylglycerol, while some pathogenic bacteria show broader specificity including phosphatidylinositol derivatives.

  • Accessibility differences: The substrate binding pocket architecture varies between species, affecting substrate access and orientation.

  • Regulatory mechanisms: Pathogen-specific regulatory elements may control lgt activity in response to environmental conditions not relevant to B. longum.

  • Inhibitor sensitivity: Differential responses to known inhibitors like globomycin derivatives provide opportunities for selective targeting.

These differences could potentially be exploited for developing antimicrobials that selectively inhibit pathogenic bacterial lgt while sparing beneficial bacteria like B. longum.

How can site-directed mutagenesis be used to probe the functional mechanisms of B. longum lgt?

Site-directed mutagenesis provides powerful insights into B. longum lgt function:

  • Catalytic residue identification: Mutating conserved residues (analogous to Arg143 and Arg239 in E. coli lgt) to alanine should significantly reduce activity if they are involved in catalysis .

  • Substrate binding analysis: Mutations in the predicted phosphatidylglycerol binding pocket would alter substrate affinity without necessarily eliminating catalytic activity.

  • Membrane interaction studies: Mutating residues at the membrane interface can reveal how the enzyme positions itself within the bilayer.

  • Protein-protein interaction sites: Identifying residues involved in recognizing the prolipoprotein substrate.

  • Conformational dynamics: Introducing cysteine pairs for disulfide cross-linking can trap specific conformational states.

A systematic mutagenesis strategy would target:

  • Strictly conserved residues across bacterial species

  • Residues unique to Bifidobacterium lgt enzymes

  • Predicted substrate-binding residues based on structural models

  • Membrane-interface residues

What approaches can effectively study the membrane interactions of B. longum lgt?

Understanding membrane interactions requires specialized techniques:

  • Fluorescence spectroscopy: Using environmentally sensitive probes attached to specific lgt residues to monitor membrane insertion and conformational changes.

  • Neutron reflectometry: Providing detailed information about the depth and orientation of the protein within model membranes.

  • Molecular dynamics simulations: Revealing how the enzyme interacts with lipids and adapts to different membrane compositions.

  • Microscale thermophoresis: Measuring binding affinities to different lipid compositions.

  • Native mass spectrometry: Identifying specifically bound lipids that copurify with the enzyme.

  • Hydrogen-deuterium exchange: Mapping solvent-accessible regions that change upon membrane association.

These approaches collectively provide a comprehensive view of how B. longum lgt positions itself in the membrane and how this positioning affects function.

How can high-throughput screening be adapted to identify inhibitors specific to pathogenic bacterial lgt while sparing B. longum lgt?

Designing selective screening campaigns requires careful consideration:

  • Primary assay development: A fluorescence-based assay measuring lgt activity from both B. longum and pathogenic bacteria (e.g., E. coli, S. aureus) in parallel.

  • Compound library selection: Focusing on natural products, synthetic lipid analogs, and in silico designed compounds targeting unique features of pathogenic lgt.

  • Counterscreening strategy: All hits against pathogenic lgt must be tested against B. longum lgt to identify selective inhibitors.

  • Selectivity metric: Calculating the ratio of IC50 values (B. longum lgt/pathogenic lgt) to quantify selectivity.

  • Structure-activity relationship analysis: Systematic modification of hit compounds to enhance selectivity.

  • Mechanistic characterization: Determining whether selective compounds are competitive, noncompetitive, or uncompetitive inhibitors.

  • Cell-based validation: Testing effects on bacterial growth and lipoprotein processing in both pathogenic bacteria and B. longum.

Screening LayerPurposeAssay TypeThroughput
Primary ScreenIdentify pathogenic lgt inhibitorsFluorescence-based activityHigh (100,000+ compounds)
Counter ScreenTest activity against B. longum lgtIdentical fluorescence assayMedium (hits only)
Orthogonal ValidationConfirm mechanismMass spectrometryLow (selective hits only)
Cell-based AssessmentEvaluate bacterial selectivityGrowth inhibitionMedium (selective hits only)

How does lgt activity influence the probiotic properties of Bifidobacterium longum?

Lgt activity significantly impacts probiotic functionality through multiple mechanisms:

  • Surface presentation of immunomodulatory lipoproteins: Properly modified lipoproteins on the bacterial surface interact with host immune receptors, potentially contributing to anti-inflammatory effects.

  • Adhesion capabilities: Several lipoproteins function as adhesins mediating attachment to intestinal mucus and epithelial cells, a property confirmed in B. longum subsp. longum BG-L47, which exhibits good mucus adhesion properties .

  • Nutrient acquisition: Lipoproteins often function as substrate-binding components of ABC transporters for carbohydrates and other nutrients, supporting growth in the competitive gut environment.

  • Stress resistance: Proper lipoprotein modification contributes to cell envelope integrity, enhancing survival under bile and acid stress conditions, as demonstrated by BG-L47's superior bile and acid tolerance compared to other strains .

  • Interspecies interactions: Surface lipoproteins mediate interactions with other microbiome members, potentially explaining how B. longum subsp. longum strains like BG-L47 can boost the growth and activity of other probiotic bacteria like Limosilactobacillus reuteri .

What methodologies can assess the impact of lgt-modified lipoproteins on host-microbe interactions?

Several complementary approaches provide insights into the function of lgt-modified lipoproteins:

  • Conditional knockdown systems: Since lgt deletion is typically lethal, inducible antisense RNA or CRISPR interference systems can reduce lgt expression to study effects without complete loss.

  • Modified lipoprotein identification: Comparative proteomics of membrane fractions with and without lgt knockdown identifies specifically affected lipoproteins.

  • Epithelial cell models: Transepithelial electrical resistance (TEER) measurements and cytokine profiling with wild-type versus lgt-knockdown B. longum assess barrier function and immunomodulatory effects.

  • Ex vivo tissue explants: Intestinal tissue cultures exposed to differently modified bacteria provide insights into tissue-level responses.

  • Gnotobiotic animal models: Colonization studies comparing wild-type and lgt-modified strains reveal in vivo relevance.

  • Extracellular vesicle analysis: Since B. longum longum BG-L47 can boost the bioactivity of membrane vesicles from other bacteria, examining vesicle composition and function with altered lgt activity provides insights into interspecies mechanisms .

How can recombinant B. longum lgt be utilized to engineer improved probiotic strains?

Recombinant lgt technology enables several probiotic engineering strategies:

  • Optimized lipoprotein processing: Controlled expression of lgt can enhance the surface display of beneficial lipoproteins.

  • Heterologous lipoprotein expression: Introducing genes for beneficial lipoproteins from other bacteria, properly processed by B. longum lgt.

  • Designer lipid modifications: Engineering lgt variants with altered substrate specificity to create novel lipoprotein modifications with enhanced stability or functionality.

  • Biosensor development: Creating B. longum strains with reporter-fused lipoproteins that respond to intestinal conditions.

  • Vaccine delivery systems: Engineering B. longum to display immunogenic epitopes as lipoproteins for mucosal vaccination.

  • Controlled colonization: Developing strains with inducible lgt expression to allow regulated persistence in the gut.

These approaches could potentially enhance the already favorable properties of strains like BG-L47, which has demonstrated safety in human clinical studies while boosting the activity of other probiotic bacteria .

How can B. longum lgt be utilized for protein engineering and biotechnological applications?

B. longum lgt offers several innovative biotechnological applications:

  • Protein lipidation platform: Using purified recombinant lgt for in vitro lipidation of target proteins, enhancing membrane association or creating anchored enzyme systems.

  • Vaccine adjuvant technology: Lipidation of antigens using B. longum lgt can significantly enhance immunogenicity through improved interaction with pattern recognition receptors.

  • Biosensor development: Creating lipid-anchored reporter proteins with improved membrane integration and stability.

  • Enzyme immobilization: Lipidation of industrial enzymes for attachment to membranes or lipid-based materials, enhancing stability and reusability.

  • Targeted drug delivery: Modifying therapeutic proteins with lipids for incorporation into liposomes or association with cell membranes.

  • Synthetic biology applications: Incorporating lgt into cell-free systems for the production of membrane proteins in artificial cells or vesicles.

The notable advantage of using B. longum lgt for these applications is its adaptation to function under the mild conditions compatible with sensitive biological molecules.

What analytical methods can track and quantify lgt-mediated protein modifications?

Robust analytical methods are essential for monitoring lgt-catalyzed reactions:

MethodApplicationAdvantagesLimitations
Mass SpectrometryPrecise mass shift detectionDefinitive identification, site localizationComplex sample preparation
Gel Shift AssaysMobility change visualizationSimple equipment, rapid resultsLimited quantification
Radiolabeled Lipid IncorporationSensitive quantificationHighly sensitive, quantitativeSafety concerns, specialized facilities
Fluorescence Resonance Energy TransferReal-time monitoringIn situ observation, kinetic dataRequires specialized substrate design
Surface Plasmon ResonanceMembrane interaction analysisLabel-free, real-timeRequires surface immobilization
Circular DichroismStructural changes upon lipidationInformation on conformational effectsLower sensitivity

For routine analysis, mass spectrometry-based approaches offer the best combination of specificity and sensitivity, with intact protein MS providing confirmation of modification and tandem MS verifying the exact modification site.

What strategies can optimize recombinant B. longum lgt for industrial scale protein modification?

Scaling lgt-catalyzed reactions for industrial applications requires several optimization strategies:

  • Expression system enhancement: Codon optimization, chaperone co-expression, and fermentation process development to increase lgt yield.

  • Enzyme stabilization: Immobilization techniques, directed evolution for thermostability, and formulation with stabilizing excipients.

  • Reaction engineering: Development of continuous flow systems, membrane reactors, or packed bed reactors containing immobilized lgt.

  • Substrate delivery systems: Micelle or liposome formulations to present lipid substrates in an accessible form without precipitation or aggregation.

  • Downstream processing: Efficient methods to separate modified proteins from unmodified precursors and reaction components.

  • Quality control: Establishing analytical protocols and acceptance criteria for lipidated products.

Process optimization would focus on maintaining enzyme activity while maximizing throughput and minimizing costs, potentially through recycling of the enzyme and optimization of cofactor concentrations.

What are the key unresolved questions regarding B. longum lgt function and applications?

Despite significant advances, several important questions remain unanswered:

  • Structural uniqueness: How does the structure of B. longum lgt differ from other bacterial lgts, and what implications does this have for substrate specificity and inhibitor design?

  • Regulatory mechanisms: How is lgt expression regulated in B. longum under different environmental conditions encountered in the gut?

  • Lipoprotein repertoire: What is the complete set of lipoproteins modified by lgt in B. longum, and how does this compare to pathogenic bacteria?

  • Host interaction mechanisms: Which specific lgt-modified lipoproteins are responsible for interactions with host cells, and what are the molecular details of these interactions?

  • Biotherapeutic potential: Can B. longum lgt be effectively harnessed for the production of lipidated therapeutics with enhanced efficacy?

What emerging technologies might advance B. longum lgt research in the near future?

Several cutting-edge technologies promise to accelerate research in this field:

  • Cryo-electron tomography: Visualizing lgt in its native membrane environment at near-atomic resolution.

  • AI-driven protein structure prediction: Improved models of B. longum lgt structure and dynamics through methods like AlphaFold2.

  • Genome-wide CRISPR interference: Systematic identification of genetic interactions with lgt in B. longum.

  • Single-molecule enzymology: Observing individual lgt molecules during catalysis to reveal conformational changes and reaction intermediates.

  • Microfluidic systems: High-throughput screening of substrate specificity and inhibitor binding.

  • Synthetic microbiology: Creating minimal cells with defined lipoprotein modification systems to understand the essential functions.

  • Advanced mass spectrometry: Improved techniques for membrane protein analysis and lipidomics to better characterize lgt substrates and products.

These technologies collectively promise to provide unprecedented insights into the structure, function, and applications of B. longum lgt in the coming years.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.