Recombinant Bifidobacterium longum Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression Systems

Recombinant B. longum Protease HtpX homolog is typically produced using Escherichia coli as an expression host. The gene encoding htpX is cloned into suitable expression vectors, allowing for the synthesis of the recombinant protein with an N-terminal histidine tag . This approach facilitates protein purification through affinity chromatography methods.

Role in Heat Stress Response

HtpX is classified as a heat shock protein and plays a significant role in bacterial responses to thermal stress . In Bifidobacteria species, heat shock proteins are overrepresented in both proteome and transcriptome analyses following exposure to elevated temperatures . This upregulation suggests that htpX contributes to the cellular defense mechanisms against heat-induced damage.

Heat stress can cause protein misfolding and aggregation, potentially leading to cellular dysfunction and death. As a protease, htpX likely participates in the degradation of heat-damaged proteins, thereby maintaining proteostasis within the bacterial cell. This function is particularly important for probiotic bacteria like Bifidobacterium longum, which may encounter temperature fluctuations during manufacturing processes or gastrointestinal transit .

Proteolytic Activities

Based on studies of HtpX in E. coli, this protein exhibits zinc-dependent proteolytic activity. When supplemented with Zn²⁺, the purified enzyme demonstrates self-cleavage activity and can degrade substrate proteins such as casein . It has also been shown to cleave membrane proteins like SecY, both in vitro and in vivo .

In bacterial cells, htpX appears to function in conjunction with other proteases, such as FtsH, as part of a membrane-localized proteolytic system responsible for quality control of membrane proteins . This system helps eliminate misfolded or damaged membrane proteins that could otherwise impair cellular function.

Potential Role in Stress Response Network

The htpX protein likely functions as part of a broader stress response network in Bifidobacterium longum. In bifidobacteria, heat stress responses involve a coordinated regulation of multiple genes, including those encoding various heat shock proteins and molecular chaperones such as dnaK, dnaJ, groL, groS, lon, clpB, clpC, clpX, clpP1, and clpP2 . Together, these proteins help maintain cellular integrity under adverse conditions.

Interestingly, transcriptome analyses of Bifidobacterium longum NCC2705 under heat stress conditions have revealed differential expression of numerous genes, with heat shock proteins being particularly upregulated . While simultaneously, genes related to translational machinery, cell division, and chromosome partitioning are downregulated, indicating a strategic reallocation of cellular resources during stress .

Biotechnological Applications

The recombinant production of B. longum htpX offers opportunities for various biotechnological applications. As a zinc-dependent protease with specificity for certain substrates, it could potentially be utilized in protein engineering or as a research tool for studying protein degradation pathways.

Probiotic Research

Understanding the function of htpX in Bifidobacterium longum contributes to our knowledge of how these beneficial bacteria adapt to stress conditions. This information is valuable for improving the survival and efficacy of probiotic formulations containing Bifidobacterium species. By characterizing stress response mechanisms, researchers can develop strategies to enhance bacterial viability during production, storage, and gastrointestinal transit .

Model for Membrane Protein Quality Control

The htpX protein serves as a model for studying membrane protein quality control systems in bacteria. Research on this protein and its interactions with other components of the proteolytic machinery can provide insights into fundamental cellular processes that maintain membrane integrity under stress conditions.

Comparison with HtpX from Other Species

While the specific characteristics of B. longum htpX are still being fully elucidated, comparisons with homologous proteins from other bacterial species provide valuable insights. The HtpX protein from E. coli, for instance, has been more extensively characterized and shown to be a zinc-dependent endoprotease involved in membrane protein quality control .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the order method and location. Please contact your local distributor for precise delivery estimates.

Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and storing in aliquots at -20°C/-80°C for long-term storage. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its use.
Synonyms
htpX; BL0551; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Bifidobacterium longum (strain NCC 2705)
Target Names
htpX
Target Protein Sequence
MHGHFNGLKTTLLFALMWAIIMLIWWATGGSRQTLSIYIVIGLITTFGTYWFSDKLAIAS MGAREVSEQEAPEIYQIVRELSAKAGKPMPRIYIAPTMSPNAFATGRNERHAAVCCTQGI LQILNARELRGVLGHELMHVYNHDILTSAIASAMATVISYLGYSLMYFGGGSRDDRDSSG GLGLIGALLSVILAPIAASLIQMAISRTREYDADEDGSLLTGDPEALASALNKISYGAQT TPMRKTAGTQSVSAMMIANPFSAVGFSRLFSTHPPTDERIARLMQMANEMNGTPIAPPTY STRVGR
Uniprot No.

Target Background

Database Links

KEGG: blo:BL0551

STRING: 206672.BL0551

Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the HtpX protease and what role does it play in bacterial physiology?

HtpX is an M48 family zinc metalloproteinase primarily located in the cytoplasmic membrane of bacteria. In bacterial systems such as E. coli, HtpX functions in the quality control of membrane proteins by eliminating malfolded and misassembled membrane proteins that could potentially disrupt membrane structure and function. This protective mechanism is crucial for maintaining normal cellular activities and membrane integrity. HtpX typically contains multiple hydrophobic regions that function as transmembrane segments, though the exact membrane topology can vary between bacterial species and remains subject to investigation in some cases. The protease domain contains conserved motifs characteristic of zinc metalloproteinases, including catalytic residues essential for proteolytic activity.

How does the expression of HtpX and related proteins change under stress conditions?

Stress conditions significantly alter the expression profile of proteases like HtpX. In Bifidobacteria, various stressors including heat, oxygen, and nutrient limitation trigger differential gene expression. For instance, in B. longum NCC2705, shifting cells from 37°C to 50°C results in differential expression of 46% of genes. Under heat stress conditions, several heat shock proteins (Hsps) are overexpressed at both the transcriptional and translational levels. Simultaneously, genes related to translational machinery, cell division, and chromosome partitioning are downregulated, indicating a strategic reduction in general metabolic activities as a survival mechanism. This pattern suggests that HtpX and related proteases may be part of a coordinated stress response system that balances reduced metabolic activity with enhanced protective functions.

What structural features characterize HtpX proteases across bacterial species?

HtpX proteases show several conserved structural features across bacterial species. Taking the well-characterized E. coli HtpX as an example, the protein typically contains:

Structural FeatureDescriptionFunction
Hydrophobic regionsFour hydrophobic regions (H1-H4)Potential transmembrane segments that anchor the protein in the cytoplasmic membrane
Zinc-binding motifConserved metal-binding residuesEssential for metalloprotease catalytic activity
Conserved glutamateE140 in E. coli HtpXCritical catalytic residue (mutation to alanine ablates activity)
C-terminal domainLess conserved regionMay be involved in substrate recognition or regulation

The precise membrane topology of HtpX remains somewhat controversial, particularly whether the two C-terminal hydrophobic regions are truly embedded in the membrane in all species. In E. coli, research has employed catalytically ablated mutants (E140A) to prevent self-cleavage during expression and purification, suggesting this residue is essential for proteolytic function.

How can researchers effectively distinguish between direct substrates of HtpX and indirect effects in stress response pathways?

Distinguishing direct HtpX substrates from indirect effects requires systematic experimental approaches. Researchers should:

  • Develop model substrates specifically designed for HtpX, similar to how investigators constructed "XMS1" (HtpX model substrate 1) for E. coli HtpX. These model substrates allow for semiquantitative assessment of protease activity in vivo.

  • Implement parallel analysis of wild-type and catalytically inactive mutants (e.g., through mutation of the conserved glutamic acid residue to alanine) to identify differences in substrate processing.

  • Perform comparative proteomics between wild-type and ΔhtpX strains under various stress conditions to identify differentially accumulated membrane proteins.

  • Validate candidate substrates through in vitro cleavage assays with purified HtpX, though this requires careful membrane protein reconstitution to maintain native structure and orientation.

The strength of this approach lies in its ability to systematically identify proteins directly processed by HtpX while controlling for broader cellular changes during stress responses that may indirectly affect protein levels.

What are the molecular mechanisms governing HtpX activation during heat stress in Bifidobacterium longum?

The molecular mechanisms governing HtpX activation during heat stress in B. longum involve a complex interplay of transcriptional, translational, and post-translational regulation. Based on research with B. longum NCC2705, several key mechanisms appear to be involved:

  • Transcriptional upregulation: When B. longum NCC2705 is shifted from optimal growth temperature (37°C) to heat stress conditions (50°C), significant transcriptional changes occur, affecting approximately 46% of genes, potentially including htpX.

  • Translation rescue mechanisms: Heat stress induces the expression of transfer-messenger RNA (tmRNA; SsrA) binding protein SmpB, which is essential for the trans-translation machinery. This system rescues stalled ribosomes that can form due to various stress-induced issues. A complex of tmRNA, SmpB, and elongation factor Tu (EF-Tu) interacts with stalled ribosomes, allowing degradation of the nascent polypeptide and mRNA while releasing the ribosomes.

  • Oxidative stress connection: Heat stress in B. animalis subsp. lactis BB-12 results in increased abundance of thioredoxin peroxidase, which detoxifies hydrogen peroxide (H₂O₂). This response suggests that heat stress promotes oxidative stress under aerobic conditions, potentially creating a secondary signal for HtpX activation.

This multilayered regulation likely ensures that HtpX is activated precisely when needed to maintain membrane protein quality control during heat stress.

How do mutations in conserved regions affect the protease activity of HtpX?

Mutations in conserved regions can significantly alter HtpX protease activity. In vitro assay systems have been developed that enable detection of differential protease activities of HtpX mutants carrying mutations in conserved regions. One critical mutation is the conversion of the catalytic glutamate residue (E140 in E. coli HtpX) to alanine, which effectively abolishes proteolytic activity. This mutation has been strategically employed to prevent self-cleavage during protein expression and purification.

The following table summarizes key conserved regions and the effect of mutations:

Conserved RegionExample MutationEffect on ActivityApplication
Catalytic glutamateE140A (E. coli)Abolishes activityUsed to prevent self-cleavage during expression
Zinc-binding motifMutations in metal-binding residuesReduced or abolished activityStructure-function studies
Transmembrane segmentsHydrophobicity alterationsDisrupted membrane insertionTopology studies

In vivo protease activity assay systems can provide semiquantitative assessment of how different mutations affect HtpX function. These systems typically employ model substrates that generate easily detectable products when cleaved by active HtpX.

What expression systems are most effective for producing recombinant HtpX proteases?

For effective expression of recombinant HtpX proteases, researchers should consider the following approaches based on successful protocols:

The expression system should be tailored to the specific research goals – whether structural studies requiring larger quantities of purified protein or functional studies needing active enzyme.

How can researchers establish reliable in vivo protease activity assays for HtpX homologs?

Establishing reliable in vivo protease activity assays for HtpX homologs requires careful experimental design. Based on successful systems developed for E. coli HtpX, researchers should consider:

  • Model substrate construction: Design and construct model substrates specific to the HtpX homolog under investigation. For example, researchers working with E. coli HtpX developed "XMS1" (HtpX model substrate 1) that allows for semiquantitative assessment of protease activity.

  • Detection methods: Incorporate reporter elements into the model substrate that enable sensitive detection of proteolytic activity. Options include:

    • Fluorescent tags (such as GFP or monomeric superfolder GFP)

    • Epitope tags for immunodetection (e.g., Myc, FLAG, or HA tags)

    • Enzymatic reporters (such as horseradish peroxidase)

  • Controls and normalization: Include both positive and negative controls in all assays:

    • Wild-type HtpX as positive control

    • Catalytically inactive HtpX (e.g., E140A mutant) as negative control

    • Vector-only controls to assess background proteolysis

  • Quantification approach: Implement methods to quantify cleavage products:

    • Western blot analysis with densitometry

    • Fluorescence measurements if using fluorescent reporters

    • Mass spectrometry for precise identification of cleavage sites

This approach allows for sensitive detection of differential protease activities between wild-type and mutant HtpX proteins, enabling structure-function studies and investigation of regulatory mechanisms.

What strategies can be employed to maintain HtpX stability during purification?

Maintaining HtpX stability during purification presents challenges due to its nature as a membrane protease with potential self-cleavage activity. Researchers should implement the following strategies:

  • Prevention of self-proteolysis: Design catalytically inactive mutants (such as E140A in E. coli HtpX) that maintain structural integrity but lack proteolytic activity to prevent self-cleavage during expression and purification.

  • Optimal buffer conditions: Utilize buffers containing:

    • Tris/PBS-based buffers at pH 8.0

    • 6% Trehalose as a stabilizing agent

    • Appropriate detergents for membrane protein solubilization

  • Storage recommendations:

    • Store purified protein at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

    • Prepare working aliquots and store at 4°C for up to one week

    • Add glycerol (final concentration 5-50%) for long-term storage

  • Reconstitution protocol:

    • Briefly centrifuge vials before opening

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Aliquot with glycerol for long-term storage at -20°C/-80°C

These approaches have been successfully applied to maintain stability of recombinant proteases including HtpX homologs during purification and storage, allowing for subsequent functional and structural studies.

How can researchers differentiate between temperature effects on enzyme activity versus protein stability when studying HtpX from thermophilic Bifidobacteria?

Differentiating between temperature effects on enzyme activity versus protein stability requires systematic experimental approaches:

  • Thermal shift assays: Monitor protein unfolding at different temperatures using fluorescent dyes that bind to hydrophobic regions exposed during denaturation. This provides direct measurement of thermal stability independent of activity.

  • Activity temperature profiles: Measure enzyme activity across a temperature range using short incubation times to minimize denaturation effects. Plot both activity and stability curves on the same graph to identify:

    • Temperature optimum for activity

    • Onset of thermal denaturation

    • Temperature range where activity decreases before denaturation occurs

  • Comparative analysis with heat-resistant derivatives: Compare wild-type HtpX with heat-resistant derivatives (similar to those identified in B. longum NCC2705) to distinguish activity changes from stability effects. Heat-resistant derivatives often show lower constitutive production of proteins associated with central carbon metabolism than parental strains, including key enzymes like Xfp.

  • Monitoring structural integrity: Use circular dichroism spectroscopy to monitor secondary structure changes at different temperatures, providing direct evidence of protein denaturation independent of activity measurements.

This multilayered approach allows researchers to determine whether observed changes in activity at elevated temperatures reflect intrinsic properties of the catalytic mechanism or are secondary consequences of protein denaturation.

What are the most common technical challenges in detecting HtpX activity in Bifidobacteria and how can they be addressed?

Researchers face several technical challenges when detecting HtpX activity in Bifidobacteria:

  • Oxygen sensitivity: Bifidobacteria are strict anaerobes, and oxygen exposure during sample processing can affect protein stability and activity. Moreover, heat stress can promote oxidative stress under aerobic conditions.

    • Solution: Perform all manipulations in an anaerobic chamber or under nitrogen flow, and include reducing agents in buffers to minimize oxidative damage.

  • Model substrate limitations: Lack of validated model substrates specific to Bifidobacterium HtpX homologs.

    • Solution: Develop new model substrates based on known membrane proteins in Bifidobacteria. Consider adapting the XMS1 (HtpX model substrate 1) approach that has been successful for E. coli HtpX.

  • Low expression levels: HtpX expression may be tightly regulated and present at low levels under normal conditions.

    • Solution: Use stress conditions (such as heat shock at 50°C) that are known to induce expression of stress-response proteins in Bifidobacteria. In B. longum NCC2705, shifting cells from 37°C to 50°C differentially expresses 46% of genes.

  • Interference from other proteases: Multiple proteases may be induced during stress, complicating specific attribution of activity to HtpX.

    • Solution: Use comparative studies with htpX knockout strains, complementation experiments, and specific inhibitors of other protease classes to isolate HtpX-specific activity.

These approaches can help overcome the technical challenges associated with studying HtpX activity in the challenging experimental context of anaerobic Bifidobacteria.

How might functional differences in HtpX homologs contribute to the stress adaptation capabilities of different Bifidobacterium species?

The functional differences in HtpX homologs likely play a significant role in species-specific stress adaptation capabilities of Bifidobacteria. Future research should explore:

  • Comparative genomics and proteomics: Systematic analysis of HtpX sequence conservation and divergence across Bifidobacterium species, with particular focus on catalytic domains and substrate-binding regions. This would reveal species-specific adaptations that may correlate with ecological niches.

  • Substrate specificity profiling: Different Bifidobacterium species may have evolved HtpX variants that target distinct sets of membrane proteins. Comprehensive substrate identification using techniques like SPECS (Secretome Protein Enrichment with Click Sugars) coupled with mass spectrometry could reveal these differences.

  • Stress-response network integration: Investigation of how HtpX function is integrated into broader stress response networks in different species. For example, in B. longum NCC2705, the gene encoding the heat shock protein Hsp20 is strongly induced in response to multiple stressors including heat, osmotic, oxidative, and starvation stress. The tolerance to these stressors was enhanced by homologous overexpression of hsp20, suggesting potential functional interactions with proteases like HtpX.

  • Evolutionary adaptation studies: Experimental evolution under different stress conditions could reveal how HtpX function adapts over time, potentially identifying key residues involved in species-specific stress adaptation.

Understanding these differences could provide insights into the variable stress tolerance observed across Bifidobacterium species and strains, with implications for probiotic development and therapeutic applications.

What novel methodological approaches could advance research on membrane proteases in probiotics?

Several innovative methodological approaches could significantly advance membrane protease research in probiotics:

  • Microfluidic single-cell analysis: Developing microfluidic platforms for real-time monitoring of protease activity at the single-cell level would enable investigation of cell-to-cell variability in stress responses within Bifidobacterium populations.

  • Substrate-specific biosensors: Creating genetically encoded fluorescent biosensors that respond specifically to HtpX activity would allow dynamic, non-destructive monitoring of protease function under various stress conditions.

  • Cryo-electron microscopy approaches: Applying advanced cryo-EM techniques to visualize HtpX in its native membrane environment would provide structural insights currently lacking for membrane proteases from Bifidobacteria.

  • In vivo protease activity assays: Expanding the in vivo protease activity assay systems (like those developed for E. coli HtpX) to Bifidobacterium species would enable more physiologically relevant studies. These systems allow semiquantitative and convenient detection of protease activity and can be modified to detect differential activities of HtpX mutants carrying mutations in conserved regions.

  • CRISPR-Cas9 genome editing: Applying CRISPR-based approaches to create precise mutations in htpX genes within their native genomic context would facilitate investigation of structure-function relationships without the confounding effects of overexpression.

These methodological innovations would address current limitations in studying membrane proteases in anaerobic, fastidious organisms like Bifidobacteria, potentially revealing new functions and regulatory mechanisms.

How might understanding HtpX function inform the development of stress-resistant probiotic strains?

Understanding HtpX function could significantly contribute to developing stress-resistant probiotic strains through several avenues:

  • Biomarker identification: The hsp20 gene, which has been found to be among the most strongly induced genes in B. breve UCC2003 and B. longum NCC2705 in response to multiple stressors (heat, osmotic, oxidative, and starvation), could function as a biomarker for stress in bifidobacteria. Similar studies on HtpX could identify whether it serves as a reliable stress biomarker, potentially enabling rapid screening of stress resistance in probiotic candidates.

  • Rational strain engineering: Targeted modifications of HtpX expression or activity could enhance stress tolerance. For example, in B. longum NCC2705, tolerance to heat, salt, bile salt, low-pH, and cold stress was enhanced by homologous overexpression of hsp20. Similar approaches targeting HtpX could yield strains with improved survival during gastric transit or industrial processing.

  • Process optimization: Understanding how environmental conditions affect HtpX activity could inform manufacturing processes. For instance, knowledge of how reduced metabolic activity and activation of protective functions like HtpX operate as a survival strategy could guide the development of cultivation and preservation methods that maintain probiotic viability.

  • Predictive modeling: Developing models that correlate HtpX sequence variants or expression patterns with stress tolerance phenotypes could enable prediction of strain performance under various stress conditions, accelerating strain selection and development.

This knowledge could ultimately lead to the development of next-generation probiotics with enhanced stability, survival, and therapeutic efficacy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.